KEGG   Pseudoalteromonas sp. SM9913: PSM_B0249
Entry
PSM_B0249         CDS       T01374                                 

Definition
(GenBank) putative secreted major subunit of curlin, may bind calcium
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Curlin_rpt
Other DBs
NCBI-ProteinID: ADT70289
Position
II:complement(275366..276874)
AA seq 502 aa
MKLNKSLLSCAIAIAMGASFTANANTETKAGSTSELAAKVSVSSIENAVTVKQSFSDNTA
LVSQDGDGNTALATEIGNNNDVKIAQLQNGNYAEVETTGDNNQQTYAQDGVANGFITRIT
GDNNGVYVSQFGQGLFQNNEAINIITGSDNNIDVEQGNGGHWFYNMDMRGNGNEIISSQS
GMWQEFEVLSLSGDENIIEIEQTDTWNEFKIGSLRGNENEIDVSQDGSRNIITFTDIAGD
DNEIAIEQSSGDNNTITFAAVTGNDNEIKLDQEGSNNAIESGLFDGSFNEVTVNQIGDEN
LATTELMGDNNELTAMQVGNTNEAYMGVIGSNNEFTVTQVSDFNSVHLANFNGSGNDVDL
SQSGGDENAILVQSSYPDVSLTSNDNDIDVNQVGNQNEAIVTLAGILDSNANQIDIAQNG
DINVIDLMVEGSNHSIDIAQQGEGNWVGGTGDSAFLLGGENVSFSVTQTGNYNTVEGNVI
GFNSTFSVTQLGDGNTATITQM
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaaattgaataaatcacttttaagctgtgcaattgcaattgcaatgggcgccagcttt
acagcaaacgcaaacacagaaacaaaagcaggttcaacttctgagcttgcagctaaagta
tctgtaagtagcattgagaatgctgtaacagttaagcaatcattttctgacaacacggca
ttagtctctcaagatggcgatggcaatactgcactagctactgaaatcggtaacaacaac
gatgttaaaatagctcaattacaaaatggtaattacgccgaagttgaaacaacaggtgat
aacaaccaacaaacttatgctcaagatggtgttgctaatggtttcattacgcgcataacg
ggtgataacaacggcgtttatgtttctcaattcggccaagggttatttcaaaacaatgaa
gcaatcaatattatcactggtagcgacaataatattgacgttgaacaaggaaatggcggt
cactggttttacaacatggacatgagaggtaatggtaacgaaattatttcatctcagtct
ggtatgtggcaagaatttgaagtacttagcttatcaggcgatgaaaacattattgaaatt
gaacaaacagacacctggaatgaatttaaaataggctcattacgcggtaacgaaaatgag
attgacgttagccaagatggttcacgtaacatcattacatttactgatattgctggtgat
gacaacgaaatagctattgaacaaagcagcggtgataacaataccattacttttgcagcc
gttactggtaatgataatgaaataaaactagaccaagaaggttcgaataatgctattgag
tctggtctttttgacggttcattcaatgaagtaacagttaatcaaattggtgatgaaaac
cttgcgactactgagctaatgggcgataacaatgagcttacagcaatgcaagttggtaac
actaatgaagcatacatgggtgtcattggttcaaataatgaatttacagtaacccaggtt
agtgattttaactcggttcatttagctaactttaatggtagcggtaacgatgttgatctt
agccaatcaggtggcgatgaaaacgcaattttagtgcagtcttcataccctgatgtttct
ctcacttcaaacgataacgatattgatgttaatcaagtcggtaatcaaaacgaggcgatt
gttacactagcgggtatccttgatagtaacgcaaaccaaattgatattgctcaaaatggt
gatattaacgttattgacttaatggtagaaggcagtaatcactctattgatattgcacag
caaggcgaaggtaactgggtaggtggaactggagattcagcgtttttattaggcggtgaa
aacgtttcattctctgttactcaaaccggtaactacaacactgttgaaggtaacgtaatt
ggctttaacagtacattctctgtcactcaacttggtgatggtaatacagcaacaattaca
caaatgtaa

DBGET integrated database retrieval system