KEGG   Pseudoalteromonas sp. SM9913: PSM_B0253
Entry
PSM_B0253         CDS       T01374                                 

Definition
(GenBank) chitinase B
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: LPMO_10 GbpA_2 CBM_5_12_2 CBM_5_12
Other DBs
NCBI-ProteinID: ADT70293
Position
II:283419..285014
AA seq 531 aa
MASIKLNTITLSAIAGGLLLSMLAPQVQAHGYMDSPKARQAFCQDDGGYWWPEDGTNIPN
LACRSAYLESGTVQFVQAIEFSVNTPDYLNQTAVEASIPNGTLCAGGDTAKRGMDLPSPH
WQRSDVVPNANGEIQVRYLASTPHNPSFWQFYLTKPTFNAATDVLTWQDLELVQEHQNVD
VIKDTDGERYYQMSVAIPQGRNGDAILYSRWQRNDVVGEGFYNCSDINIVNDAAPTNPNA
WASLGYFVRQGQNAIAGDTVWARLFDESGQEVINQQLKINADNQVNWQQVLASQLNLDYA
HLVQIGVQNQVGDVVFNSADVLTNQVYGSNPNYTYTLSVQGTPDNTAPIVSKPENLVVDE
NTTTAVHLHAFDDEQNALIYTWSVPAPLSFTGSDANINLISPEVSTPTDYTVVVSVSDGQ
LTTQTEFVVTVNDSVINDPAIAPWSTTEVYQATDKVSFQERVYLAKWWNQGQHPDSSSAW
ELVEEGTNPAAWSINKAYQAGAEIIYQGQRYRANWWTQGDTPGQADVWKTL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcatcaattaaacttaacacgattacgctatctgcaatcgcaggtggcttgctactg
agtatgctagcaccgcaagtacaagcacatggttatatggatagtcctaaagcacgccaa
gcattttgccaagatgatggcggatactggtggccagaagatggcacaaatattcctaac
cttgcttgtcgatcagcatatctagaatccggcacggtgcagtttgtgcaagcgattgaa
ttttctgttaatactcctgactatttaaatcaaaccgcagttgaggccagtataccaaac
ggcactttatgtgctggtggcgatacagccaaacgcggtatggatttaccatcaccacat
tggcaacgtagtgacgtagtgcccaatgctaatggtgaaattcaagttcgttaccttgca
tcaacaccacataaccccagcttttggcagttttacttaactaagccaacttttaatgcc
gctactgatgtattgacctggcaagacttagagctagttcaggagcatcaaaatgttgac
gtgattaaagacaccgatggtgagcgttattatcaaatgagtgtggctattccacaagga
cgcaacggtgatgccattttgtacagccgctggcaacgaaacgatgttgtgggtgaaggc
ttttataactgtagtgatataaatattgtaaacgacgctgctccaaccaatccgaatgcg
tgggcaagccttgggtactttgtacgtcaagggcaaaatgccattgcaggcgacactgta
tgggctcgcttatttgatgaatctggccaagaggtgattaatcaacaacttaaaatcaat
gccgataatcaagtaaattggcagcaagtgttggcgtcacaacttaaccttgattatgcg
catttagtgcagattggtgtgcaaaatcaagttggtgatgttgtatttaacagcgctgat
gtactaacaaaccaagtctatggaagcaatccaaattacacttatacattaagcgtgcag
ggcacccctgataatacagcgcctattgttagtaagccagaaaacctagtagttgatgaa
aacaccaccacggctgtgcatttacatgcgtttgatgatgagcaaaatgcgttaatttat
acttggtcagtaccggcaccactgagttttaccggtagcgatgccaatatcaacttaatt
tcacctgaagtttcaacacctacagattataccgttgtggtatctgtttctgatggccaa
ttaacgacccaaaccgagtttgttgtcaccgttaatgacagcgttatcaatgatcctgct
atagcgccttggagcactactgaggtttatcaagcaacagataaagtgagttttcaagag
cgtgtttacttagctaaatggtggaatcaaggtcagcatcccgatagttcaagtgcgtgg
gagcttgttgaggagggtactaatccagcagcatggagtattaacaaagcctatcaagca
ggcgcagaaataatctatcaaggacagcgctatcgcgctaattggtggactcaaggcgat
acgccaggacaagccgatgtatggaaaacactgtaa

DBGET integrated database retrieval system