KEGG   Pseudoalteromonas sp. SM9913: PSM_B0254
Entry
PSM_B0254         CDS       T01374                                 

Definition
(GenBank) chitinase C
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00520  Amino sugar and nucleotide sugar metabolism
psm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_B0254
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     PSM_B0254
SSDB
Motif
Pfam: Glyco_hydro_18 ChitinaseA_N CBM_5_12 Ig_3 CBM_5_12_2 ig ICAM_N GramPos_pilinBB
Other DBs
NCBI-ProteinID: ADT70294
Position
II:285088..287718
AA seq 876 aa
MNIKQLTAAMGVALFAGSVSAAPSTPSINWEPQQYSFVEVDLEGNGSYKQLVTRVEQVNI
NIEWSAWSGDGGDSYKVYFDDMLVNEGTLADGSKSGTISFPYDKAGRHTMYVELCEGGTT
CARSAGKPIVIADTDGGHLAPLPMDVDPNNRDIGVKQDLVTGAYFVEWGIYGRDYDVTNM
PAQNLSHILYGFIPICGENASLTGGPKRALETACAGSADYEVVIHDPWAAVQKALPGVDA
KDPIRGTYSQLMALKQRYPDIKILPSVGGWTLSDPFGGFTNKANRDTFVASMEEFLRTWK
FYDGVDIDWEFPGGDGPNPDIGDPINDGPAYVALMQELRAMLDKLEAETGRTYELTSAIG
AGYDKIEDVDYQAASQYMDYIFAMTYDFYGAWSNVTGHQTALYCGEHMSVGQCNGTGLDE
NGEPRKGPAYTTDNAVQLLLAQNVPSKKIVVGTAMYGRGWEGVYPQNAAVDGNPMTASGN
GPLKGSTAQGVWEDGVIDYKGVKANMIGAAGTGINGFEVGYDEQAQAAYVWNRSTGKLIT
YDSRKSVLAKGAYVNQHNLGGLFAWEIDADNGDILNAMHDGLGGVVAPPSNKKPVVSVSS
SVSVNSGESITVTASATDADNDPLSFSWSADSALVVSGQNTSSLVINAPTVTTDTQYVAT
VAVSDGQATVNRDVVVNVIAPTSGGENTAPSVNAIANVSVEEGASASVAVVANDAQNDAL
TYTWTVPAGLTLVGSGANVSIEAGAVDTDTNFTVSVAVSDGALTTTQSFSVTVTNGDTTT
PPTGDWDASVAYVGGDVVTYNGVEYKAKWWTQGERPDLGGAWEATTQPTDGTGVEVWQPT
AIYNSGDEVSYQGNKYQAKWWTQGNEPGSTDVWLAL
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgaatattaaacaattaaccgcagctatgggtgttgcactatttgccggttctgtatcg
gcagcgccttctacaccaagtattaattgggagccacagcaatattcgtttgttgaggta
gaccttgagggaaacggttcttacaaacagctggttacccgtgttgagcaagttaatatc
aacattgaatggagtgcgtggagcggtgatggcggcgatagctataaagtgtactttgat
gacatgctagtaaatgagggcacgcttgctgatggttctaaaagtggcactatttcattc
ccttatgataaagcaggccgccatacaatgtatgttgaactatgtgaaggcggcacgacc
tgtgcaagaagtgcgggtaagccaattgtaattgctgacactgacggcggacatttagca
ccattacctatggatgttgacccaaataaccgtgatattggcgttaagcaagatttagtg
acgggcgcttactttgttgagtgggggatctatggccgtgattacgatgtaacgaatatg
ccagcacaaaacctgagtcatattttgtatggcttcattccaatttgtggtgaaaatgcg
tcgttaactggcggtcctaagcgcgcactggaaacagcctgtgcgggctctgcagattac
gaagtggttattcacgacccatgggccgcagtacaaaaagcattgccaggggttgatgct
aaagatcccattcgtggtacttactcgcagttaatggcactaaaacagcgctaccccgat
attaaaattttaccatctgtaggtggttggacgttatcagacccatttggtggttttact
aataaagcaaaccgcgacacctttgttgcctcaatggaagagtttttaagaacctggaag
ttttacgatggtgttgatattgactgggaattcccaggtggtgacggccccaatcctgat
attggcgatccaattaacgatggcccagcctatgtggcgcttatgcaagagctgcgcgct
atgcttgataagctagaagcagaaacgggtcgtacttacgagttaacctcagccattggt
gctggttacgataaaattgaagatgtagattatcaagccgcaagccagtacatggattac
atttttgccatgacctatgacttttatggtgcatggagtaacgtaactggtcatcaaact
gcactttactgtggcgagcacatgagtgttggtcaatgtaatggcactgggcttgatgaa
aatggcgaacctcgtaaaggccctgcttataccaccgataatgcagtacagctgttactt
gcgcaaaatgtaccatcgaaaaaaatcgtcgtcggcacagccatgtatggccgtggttgg
gaaggtgtttacccgcaaaatgcagcggttgatggtaacccaatgaccgcctctggtaat
ggcccgttaaaaggctccacggcacaaggtgtatgggaagatggagttattgattacaaa
ggcgttaaagccaatatgattggtgcggcaggcaccggtattaatggttttgaagtgggt
tatgatgagcaagcacaagccgcttatgtatggaatcgctcaactggtaaactgatcacc
tatgatagccgtaagtctgtgctggccaaaggtgcgtatgttaatcagcataacttaggc
ggtttatttgcatgggaaattgatgctgacaatggtgacattctaaatgcaatgcatgat
ggcttagggggcgtagttgcgccgccaagtaataaaaaaccggttgtttcagtgtcttca
tctgtgtctgttaattcaggcgagagcatcacagtaacggcttctgcaaccgatgcagat
aacgatccactgagctttagctggagtgctgatagcgcgctagtagtatctggacaaaat
acatcatcactggttattaatgcgccaacagtgactacagatacacagtatgttgcaacc
gttgcggtatcagatggtcaagcaacagtaaatcgtgatgttgttgttaatgttattgcg
ccgacatcaggcggcgaaaatacagcaccgagtgttaatgcaattgctaatgttagtgtt
gaagaaggcgcatcagcaagtgttgctgtagttgcaaacgatgcacaaaacgatgcgctt
acatatacgtggacagtaccagcaggcttaacgttagtgggcagcggtgcaaatgtaagt
attgaggcaggcgctgtagatacagatacaaacttcactgtttcagttgcagtaagtgat
ggcgcattaactacaacgcaaagctttagcgtaacagtgacaaatggtgatactaccact
ccaccaacaggagattgggatgcgagtgttgcatacgttggtggcgatgtcgtcacttat
aacggcgttgaatataaagcaaagtggtggactcaaggcgagcgtcctgatttaggtggt
gcgtgggaggcaacaacacagcctacagatggtacgggtgtcgaagtttggcagccaacg
gctatttataacagtggtgatgaagtttcttatcaaggtaataagtaccaagctaaatgg
tggactcaagggaacgagccaggctcaaccgatgtatggttagcactttaa

DBGET integrated database retrieval system