KEGG   Pseudoalteromonas sp. SM9913: PSM_B0255
Entry
PSM_B0255         CDS       T01374                                 

Definition
(GenBank) ribonuclease activity regulator protein RraA
  KO
K02553  regulator of ribonuclease activity A
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:psm03019]
    PSM_B0255
Messenger RNA biogenesis [BR:psm03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     PSM_B0255
SSDB
Motif
Pfam: RraA-like
Other DBs
NCBI-ProteinID: ADT70295
Position
II:complement(287797..288279)
AA seq 160 aa
MTQFTTPDLYDEHRDHVQVADSGLQHFGNKTLFYGQVVTVTCPDDNSFAGNILHENGEGK
VLVVDGFASKRFAFIGDMIAERALKNGWQGIIINGCCRDIEILATLDLPVMALGATPRCT
TKRGLGAKDHPVNMLNTTINTGDWVYADVNGLIISNKALF
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacacagtttactacgcccgatttatacgatgaacatcgcgaccatgtgcaagtcgct
gacagtggcttgcaacactttggtaataaaactctcttttatggtcaagtagtgactgtc
acctgcccagacgataactcgtttgctggcaacatattacatgaaaatggtgaaggcaaa
gtgttggttgtggatggctttgctagtaagcgttttgcattcattggcgatatgattgca
gagcgagccctaaaaaatggctggcaaggcattattattaatggttgctgccgcgatatt
gaaattcttgccacgcttgatttacccgtgatggcgctaggcgctacgccgcgctgcacc
actaagcgcggtttaggtgccaaagatcacccggttaatatgttaaacaccacaattaat
accggtgattgggtgtatgctgatgtcaatggattaattattagtaataaagccttgttt
tga

DBGET integrated database retrieval system