KEGG   Pseudoalteromonas sp. SM9913: PSM_B0256
Entry
PSM_B0256         CDS       T01374                                 

Gene name
cstA
Definition
(GenBank) cold-shock regulated carbon starvation protein A
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: CstA CstA_5TM
Other DBs
NCBI-ProteinID: ADT70296
Position
II:288619..290082
AA seq 487 aa
MIIFFICLTILILGYKFYSPFVEKQAGMDSTVDTPQKRFSEGVDYVAIHPVRAFLIQFLN
IAGVGPIFGPILGALYGPVALVWIVLGNVLGGAVHDFFSGVMSIKEDGKSLPEIAGHYYN
VVFKGFMLIFTAMLLFFVGVVFIMSPAGLLSNLDIFKDTIFANNTFWVLAILAYYFLATL
LPIDKIITKFYPIFGLLMIVMTVAIAVSLLINAPHLPVAGDFLAYFEADHAHDFLAPNPD
GLPTWPLLFITITCGAISGFHSTQAPIIARCLTNEKYVRPVYYGAMMCEGIVGCVWALAG
IAAFPEGYAGLKAMLDLGGPGLVVNHIANSYLGVFGGIMAIIAVAVFPITSGDTAFRSLR
LTVVDAFSIPQSLRNRLLLAIPILTIAYFMTKLDFSVIWRYFAFSNMLLSTSVLWLATKY
LFDRGTFHWITSIPAVIATAVTLSYIMTAAIGLNLSSDLGKPIGAAVAVIGFIVLAVVHS
KHKVRTA
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatcatcttttttatttgcctaactattttaatattaggctataagttttatagcccg
tttgttgaaaagcaagcgggcatggattcaacggtcgacacaccacaaaaacgctttagc
gaaggtgttgattacgttgcaattcaccctgttcgtgcatttttgattcaatttttaaat
atagcaggcgtaggccccatatttggcccaatattgggtgcattatatggtccggttgcg
cttgtatggattgtgcttggtaatgttttgggtggcgctgtacacgactttttctcagga
gtaatgagtataaaagaagacgggaaaagcttaccggaaatagcagggcactactacaac
gttgtatttaaaggctttatgcttatttttactgcgatgctactattttttgttggtgtt
gtatttattatgagcccggcaggattattaagtaaccttgatatatttaaggatacaata
tttgcaaataataccttttgggttttggctattttagcttactactttttagccacgtta
ttacccattgataaaatcatcactaagttttaccctatttttggtttgttaatgattgtg
atgacagtagctattgcggtatcactgctaataaacgcaccgcatttaccagtagcgggc
gactttttagcatactttgaggccgatcacgctcatgacttcttagcaccaaatcctgat
ggactgcccacttggccgctgctatttataaccattacctgtggtgctattagtggtttt
cactcaacgcaagcacctattattgctcgttgtttaaccaacgaaaaatacgtacgccca
gtttattatggtgcgatgatgtgtgaaggcattgtaggttgtgtttgggcacttgctggt
attgctgcattcccagaaggctatgcgggtttaaaagctatgcttgatcttggtggtcca
ggtttggtggttaaccatattgcaaacagctacttaggtgtatttggcggtattatggca
attattgctgttgctgttttccctattacctcaggcgatacggcgtttcgttcactgcgc
ttgaccgtggttgatgcgtttagtattccgcaaagtttacgtaatcgtttattgctagca
atccctattttaaccattgcctactttatgactaagctcgatttctctgtgatttggcgc
tacttcgcattctcaaatatgctgctttctaccagtgtgttgtggcttgcgaccaagtat
ttatttgaccgtggtacattccactggatcactagtataccagcagtaatcgctacagca
gtgaccttgtcatacataatgactgcggcaatagggttaaacttatcaagtgatttaggt
aaaccgattggtgcagcggtggctgttatagggtttattgtattagctgttgtgcattca
aagcataaagtgcgtacggcttaa

DBGET integrated database retrieval system