KEGG   Pseudoalteromonas sp. SM9913: PSM_B0257
Entry
PSM_B0257         CDS       T01374                                 

Definition
(GenBank) transcriptional regulatory protein
  KO
K16137  TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psm03000]
    PSM_B0257
Transcription factors [BR:psm03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    PSM_B0257
SSDB
Motif
Pfam: TetR_N
Other DBs
NCBI-ProteinID: ADT70297
Position
II:complement(290155..290673)
AA seq 172 aa
MTKKAALLKAAENKVRLGGYSNFSFRELANEIGIKSASVHYHFPTKADLGAELAHQYTDA
FIAVLGEPEAHKANGKNPIDIYTQLFRNALVIDKKMCLCGLLGAESDSLPDKVRVEVQRF
FNKNLAWLTQAHAANGEKNPARAAIQTVSLLEGAMMISKTLDDISYFEQATF
NT seq 519 nt   +upstreamnt  +downstreamnt
atgacaaaaaaagcagccctgttaaaagcagcagaaaacaaagttagacttggtggctat
agcaattttagctttagagagttggccaatgaaattggtattaaaagtgccagtgtgcat
tatcactttccaactaaagctgatttaggtgcagagcttgcgcatcaatataccgatgcc
tttatcgctgtacttggtgaaccagaggcacacaaagcaaacggtaaaaaccctattgat
atttacactcagttatttagaaatgcactcgtgattgataaaaaaatgtgtttatgtggc
ttgctcggcgcagaaagcgacagcctacctgataaagtgcgggttgaagttcagcggttt
tttaataaaaatttagcctggttaacccaagcacacgctgcgaatggtgaaaaaaaccct
gctcgcgcggcaatacaaacagtgagcttattagagggggcgatgatgattagtaaaacc
ctagatgatatcagctacttcgaacaagccactttttag

DBGET integrated database retrieval system