KEGG   Pseudoalteromonas sp. SM9913: PSM_B0258
Entry
PSM_B0258         CDS       T01374                                 

Definition
(GenBank) glutathione transferase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C GST_C_3 GST_C_2 GST_N_5 GST_N_4
Other DBs
NCBI-ProteinID: ADT70298
Position
II:290852..291472
AA seq 206 aa
MKIYDVENFPNPLRVRIALAEKKATDKVEFVAVDLLNGEHRTEAFLAKNPLAGVPVLELD
DGTFIAECTAITEYIDTAFAGPSLTGVEAKERAVINMMQKRAESMVLDAVATYFHHATDG
LGPALETYQNVAWGEKQGEKARQGFVYFNTVLANSAYVAGENFSVADITLYAGLVFAGFA
KIAIPSELSHLIAWQEKVAQRPSIAA
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaaaatttatgatgtagaaaactttcctaatccattacgtgtacgtattgcgcttgct
gaaaaaaaggcgactgataaagtagaatttgttgctgtcgatttattaaatggtgagcac
cgtactgaggcttttttagctaaaaaccccttagcaggcgtacctgttttagagctagat
gatggaacgttcatcgcagaatgcaccgcaattactgaatatattgataccgcttttgca
ggcccttcattaaccggtgttgaggcaaaagagcgtgcagtgattaatatgatgcaaaaa
cgtgcggagtcaatggtacttgatgctgtagccacttactttcatcatgcaacggatggt
ttaggcccagcgcttgaaacctatcaaaatgttgcttggggagaaaagcaaggtgaaaaa
gcgcgccaaggctttgtttattttaatacagtgttagccaactctgcttatgttgctggt
gagaatttcagtgttgcagatattactttgtacgccggtctggtgtttgcaggctttgca
aaaatagctattcctagtgagctatcacatttaatagcatggcaagaaaaggtcgctcag
cgtccaagtattgccgcttag

DBGET integrated database retrieval system