KEGG   Pseudoalteromonas sp. SM9913: PSM_B0259
Entry
PSM_B0259         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Cupin_7 DUF4437 DMSP_lyase Cupin_2
Other DBs
NCBI-ProteinID: ADT70299
Position
II:291487..292179
AA seq 230 aa
MKIAADFSERVVVHSESLEWIASPMAGVDRRPLDRVGNEVARATSIVRYAPNSHFSAHTH
TGGEEFIVLEGVFQDEHGDFPKGSYIRNPPESKHTPSSENGCVIFVKLWQFQPEDREHVR
LQTNTMCSVPHPEFSNVNVVSLYKDAFEEVSILAFSPNSEISLNALGGGELLVLEGSLEE
QGDTLVQHSWLRVPPNSEIKATAGSEGARVWLKIGHLTDVENQIARLKNA
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaaaattgcagctgattttagcgaacgtgttgttgtacatagcgaatcgttagaatgg
atagcctcaccgatggcgggtgttgataggcgtccacttgatagagtgggcaatgaggtt
gcacgcgcaaccagcattgtacgatatgcgccaaacagccatttttctgcccatacacat
accggcggtgaagaatttattgtgcttgaaggtgtttttcaagatgaacatggtgatttc
cccaagggctcttatattcgtaatccgcctgagtcaaaacatacaccaagctctgaaaac
gggtgcgtgatatttgtgaaattatggcagtttcagccagaggatagagagcatgttcgc
ttgcaaactaataccatgtgcagcgttcctcaccctgagtttagtaatgtaaatgtagtt
tctctttataaagatgcctttgaagaggtgagtattttagcattttcacctaacagtgaa
atatcgttaaacgccttaggtgggggcgagcttttagtacttgagggctcgcttgaagag
caaggcgatacattagtacagcacagctggttaagagtgccgcctaacagcgaaattaaa
gcaacagcaggcagtgaaggagccagagtgtggcttaaaatcggtcatttaacagatgtt
gaaaaccaaatagcacggcttaaaaatgcataa

DBGET integrated database retrieval system