KEGG   Pseudoalteromonas sp. SM9913: PSM_B0260
Entry
PSM_B0260         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: SpoIIAA-like
Other DBs
NCBI-ProteinID: ADT70300
Position
II:292300..292701
AA seq 133 aa
MVNLTHGLSIGIERSGCEFFLTLKAIGTLTHKDYEVITPMIDSALGEVKHPIVNVLIDGT
ELDGWELRAAWDDLKLGLKHNKEFKKIAIYGNKDWQSTIAKLGSWFVSGEIQYFENATAA
LEWLKSNDEEADA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtaaatttaacacacggcttatctattggtattgagcgctctggttgcgagtttttt
ttaaccttaaaagctataggtacactcactcataaagattatgaggtgatcacgccgatg
attgactctgcgcttggcgaagttaaacatcctattgttaatgtactcatagatggtact
gagcttgatggctgggaacttagagctgcatgggatgatttaaaacttggcttaaagcat
aacaaagaatttaaaaaaatagccatatacggcaacaaagactggcaatcaaccatcgct
aaattaggcagttggtttgtatcaggtgaaattcaatattttgagaacgccactgcggct
ttagaatggttaaaaagtaatgatgaagaagcggatgcttaa

DBGET integrated database retrieval system