KEGG   Pseudoalteromonas sp. SM9913: PSM_B0261
Entry
PSM_B0261         CDS       T01374                                 

Definition
(GenBank) carbohydrate kinase, PfkB family protein
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00051  Fructose and mannose metabolism
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PSM_B0261
   00500 Starch and sucrose metabolism
    PSM_B0261
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_B0261
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     PSM_B0261
SSDB
Motif
Pfam: PfkB NAPRTase_N
Other DBs
NCBI-ProteinID: ADT70301
Position
II:complement(292900..293844)
AA seq 314 aa
MTKLLSLGELLIDMLPQDSQNSAYLPIAGGAPANVAVGYAKLGGKAAFCGGMGDDYFAKQ
LSKSLEQYKVSTEYLFTIKDSQTAVVIVSLDETGERSFNFYRHNTADLLLTSDHLCHIKW
DELSTLHFCSNTLTNPAIANTTVCALKLAKNNHKLVSFDVNLRYSLWQNSNDIEHNVHAC
YAYCDIVKLSRDELNFLAEQTQHAPDDYLQSILNIGVKLVFLTDGPAPATVYHKGFILNE
SAPIINAVDTTSAGDAFIAGVLYYLNHTDENSPLIEKINNEHLVKHALSFGLRCGSKACL
AKGAFPALPTLQEV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaccaaattacttagcctcggcgagctacttattgatatgctgccacaagattctcaa
aacagtgcttatttgcccattgcaggaggtgcccctgccaatgtagcggtaggttatgca
aagttaggcggcaaggctgctttttgtggcggtatgggtgatgactactttgctaaacaa
ttaagtaaatcgcttgagcaatataaagtaagtacagagtacttatttacgattaaagac
tctcaaacggccgtggttattgtgagtttagatgaaaccggtgaacgcagctttaatttt
tatcgccacaataccgccgatttactgttaacgagtgatcacttatgccatatcaaatgg
gatgaattgagtaccctacacttttgttccaacacgttaaccaatccagccattgcaaac
accaccgtgtgtgctttaaagctggctaaaaacaaccataaactcgttagctttgatgta
aatttacgctatagcttgtggcaaaatagcaatgacattgaacacaatgtacacgcgtgt
tatgcctattgcgatattgttaagctatcgcgtgatgagctgaactttttagctgagcaa
acacagcatgcacctgatgattacttacaatctattttaaatataggtgttaaattggta
tttttaaccgatggccctgcaccggcaacggtttaccataagggatttatattaaatgaa
tcggcgccaatcattaatgctgtggatactaccagtgccggtgatgcgtttattgcaggc
gtgttatattatttaaatcacaccgatgaaaatagcccgctcatcgaaaaaattaataat
gagcacctagtaaaacacgctttaagttttggtttgcgctgtggctctaaagcctgctta
gctaagggggcatttcccgcattacctacacttcaagaggtataa

DBGET integrated database retrieval system