KEGG   Pseudoalteromonas sp. SM9913: PSM_B0262
Entry
PSM_B0262         CDS       T01374                                 

Definition
(GenBank) TonB-dependent receptor
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-ProteinID: ADT70302
Position
II:complement(293970..296363)
AA seq 797 aa
MTTHNTPLYLMSALALAVSQGVYAQQEEQNTQAQANKGLETIVVTGVPRRTTIMASSSSV
SSLSLAQVEVSTPRSTAEAFRIIPGVRSESTGGEGNANIAVRGLPVASGGAKFLQLQEDG
LPVMQYGDIAFGNADIFMRLDNTVQTIESIRGGSASTAASNAPGGIINFISKNGENESGS
VSTTLGLDYDTIRTDFEYGTYLSDSVRFHVGGFVRQGEGPRETGYTSNKGGQIKANLTKD
FENGYVRLYYKHLDDKSVGYLPMPMYANGDSIPGFDAQSDTPHSALFTKTVRLNGENQIS
SGDIRDGMNPQVDSVGFEAVFDLDNDWRIENRFRKSSVSGNFNSLIPAEVGSATAIAQSI
GGAGATLSNANTGAAFNDDLAMRIHTFDVTMNDFDSIVNDFKLTKSLSDDTSVTFGYYAS
TQNIAMSWLWNSYLMELKGDNAALLNVTAADGTAFSENGLYAYGTPFWGNCCQRDYDTEY
DTRAPYVSFSTKVGDVSIDASARYDSGEARGNYAGAVTSTVDMNRDGVISVPEQNVAGID
TANASPVNYDWDYASYSIGANYQIDSSLATFARLSKGGRANADRLLFGKVRADGSVADED
AVDEVNQYEFGVKKRFDSLSVFATAFYAETEEQNFEATSQTFFDREYEAKGIEIESTYFI
DAWDFRGNLTWTDAEIAKDALTPEVVGNTPRRQADLIYSLMARYSFDKGAAGVNFIGTTD
AYAQDNNDLKFDGYTQVNGFVSYDLSENLNIALNVNNLFDTVGITEAEEGSIPDNNIIRA
RTINGRTTSITLKYAFN
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgacaacacacaacacacctttatatttaatgagtgctttagcgctggctgtaagccaa
ggcgtttatgcacaacaagaagagcaaaacacacaagcgcaagctaacaaaggtcttgag
actatcgttgtaaccggtgtaccacgtcgtacaaccattatggcatcaagctcatcagtg
agcagtttatcgcttgctcaagttgaagtatctacaccgcgttcaactgctgaagcgttt
agaattattccgggcgtacgctcagaatcaaccggcggtgaaggtaacgcaaacattgct
gtacgcggcttacctgtggcctctggtggtgctaagtttttacaattacaagaagacggt
ttacccgttatgcaatacggtgatattgcttttggtaacgctgatatatttatgcgccta
gataataccgtacaaactatcgaatcaattcgtggtggttcggcctcgactgcagcaagt
aatgcaccgggcggcataattaactttatatctaaaaatggtgaaaacgaatcaggcagt
gtttctacaacactgggccttgattacgacactattcgtacagactttgaatacggcact
taccttagtgatagcgtacgttttcatgtaggtggttttgtgcgccaaggtgaaggcccg
cgtgaaacaggttacacatcaaataaaggtgggcaaattaaagccaaccttaccaaagac
tttgaaaacggttacgtgcgtctttattacaaacatttagatgacaaaagcgtgggttac
ttaccaatgccaatgtatgcaaatggtgactcaatcccagggtttgacgcacaatcagat
accccgcattcagcattatttactaaaacagtgcgtttaaatggcgaaaatcaaattagt
agcggcgatattcgcgatggcatgaacccgcaagttgactcagtgggttttgaagctgta
tttgacttagataacgattggcgtattgaaaaccgttttcgtaaatcctctgttagcggt
aactttaattcacttattcctgctgaagtaggcagcgcgactgctattgcacaaagtatt
ggcggcgcaggtgcaacgcttagtaatgcaaataccggagctgcatttaatgacgattta
gccatgcgtattcatacgtttgacgtcacaatgaacgactttgactctattgtgaacgac
ttcaaactaactaaatcactaagcgatgatacaagcgttacatttggttactatgcttca
acgcaaaatattgctatgtcatggttatggaactcttacctaatggagcttaagggcgat
aatgcggcgctactaaatgtaacagctgctgatggtacagcgttttctgaaaatggttta
tatgcatacggaacgcctttttggggtaactgttgtcagcgtgattacgatacagaatac
gatacccgcgccccgtacgtttcattttcaacaaaagtgggtgatgtaagtattgacgca
agtgctcgttacgatagtggtgaagcacgcggtaattacgcaggtgcagtaacctctaca
gttgatatgaatcgcgatggagtgatttcagttcctgaacaaaatgtagcaggcattgat
accgcaaatgctagcccagtaaattacgattgggattatgcatcctattcaattggggct
aactaccaaatagattcaagccttgcgacatttgcaagactgagtaaaggtggccgcgca
aatgctgaccgacttttatttggtaaagtacgcgctgacggttcggttgctgatgaagat
gccgttgatgaagtaaaccagtatgaatttggggttaaaaaacgttttgattcactctca
gtttttgcaacagcgttttatgcagaaacagaagagcaaaactttgaagcaacatcgcaa
accttttttgaccgtgagtacgaagcaaaagggatagaaattgaatcaacttacttcatc
gatgcatgggattttcgtggtaacttaacatggactgatgcagaaattgctaaggatgca
cttacccctgaagtggtaggtaatacgccacgccgccaagctgatttaatctactcttta
atggctcgttatagctttgataaaggtgctgccggtgtcaactttattggtactactgat
gcttacgctcaagacaataacgaccttaaatttgacggttacactcaagtaaatggcttt
gtaagttacgatttatctgaaaaccttaatattgcacttaatgtaaataacttattcgat
acggtaggtattacagaagctgaagaaggctcaattccagataataacattattcgcgcc
cgtactattaatggccgcacaacatcaataacgcttaaatacgcgtttaactaa

DBGET integrated database retrieval system