KEGG   Pseudoalteromonas sp. SM9913: PSM_B0263
Entry
PSM_B0263         CDS       T01374                                 

Definition
(GenBank) transporter, putative
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Other DBs
NCBI-ProteinID: ADT70303
Position
II:complement(296531..297760)
AA seq 409 aa
MTKSHTHVSSDPLQQIRWLTYMMFFMFAMTSDAVGMIIPELITEFGLSMTQASAFHYAPM
ALIAFSGLFLGFLADSLGRKKTIMLGLLIFSASCFLFAISSSFIFFVFLLCCIGLAIGLF
KTGALALLGDISHSNAEHTKTMNKVEGFFGIGAIVGPALVGVLLVQNVSWTYLYIIAGIM
CLILAFLAWRAEYPSVVKSTEKPASLATTMKMIKNPYALGFSLAIALYVATEVAIYVWMP
TLLKDYTGSWPLLATYALTIFFILRAAGRFIAVWLLNRYSWQGVMAYLSLGIALCYVGTL
VGGVDWAVGLLPLSGLFMSMVYPTLNSKGISCFPVQQHGAVAGVILFFTALSAALAPLFM
GMISDYFGHVRYGFYLATGFAIILFLAMLFNYFRDPSASALQESNLITE
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgacaaaatcacacacacacgtaagcagcgatccgttgcaacaaattcgctggctcaca
tatatgatgttttttatgtttgccatgacctccgatgccgttggcatgatcattcccgag
ctcataactgaatttggtttaagcatgacccaagccagcgcattccactatgcgcctatg
gcactcattgcctttagcggattatttttaggctttttagccgatagcctcgggcgtaaa
aaaacgattatgcttgggttattaatattttctgcgagttgctttttattcgccattagt
agcagctttatattttttgtttttttgctttgctgtattggtttagctattggcttattt
aaaaccggcgctttggcgttattaggcgatatttctcatagcaacgcagagcacactaaa
accatgaacaaagtagaaggcttttttggtattggtgccattgttggacctgcacttgtt
ggtgtattactggtacaaaatgtaagttggacttatttatatattattgccggcattatg
tgcttaattttagcgtttttggcgtggcgtgcagagtatccaagcgttgttaaaagcact
gaaaagcccgcttcacttgctaccaccatgaaaatgattaaaaacccctacgcgcttggc
ttttcgctcgccattgcgctttatgttgcaaccgaggttgccatttacgtatggatgccg
acgctgttaaaagactacacaggctcttggccccttttggcaacctatgcactcaccata
ttttttatactgcgtgccgcagggcgttttattgcggtgtggttattaaaccgctatagc
tggcaaggtgttatggcttacttaagtttaggtatcgcattgtgttatgtgggtacttta
gtcggtggcgttgattgggctgttggtttattgccgctttcagggttatttatgtcgatg
gtttacccaaccttaaactccaaaggaatatcgtgcttcccggtacaacaacatggcgca
gttgctggggttatattatttttcactgcactttcagccgcattagcgcctttatttatg
ggtatgatcagcgattactttggtcatgtacgttatggtttttaccttgcaaccggcttt
gccattattttatttttagcgatgctgtttaactatttccgtgacccatcagccagcgct
ttacaagagagcaacctaataactgagtaa

DBGET integrated database retrieval system