KEGG   Pseudoalteromonas sp. SM9913: PSM_B0266
Entry
PSM_B0266         CDS       T01374                                 

Definition
(GenBank) AraC/XylS family transcription factor
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: AraC_N HTH_18 HTH_AraC
Other DBs
NCBI-ProteinID: ADT70306
Position
II:complement(300595..301488)
AA seq 297 aa
MHTSQLNKKRQQLDVLIENKVTFAADNSELSIYDTYKSAQKVALHSNELLFCAMLSGKKI
MHVESSQYHKAFLPHESFVLAPEQSVLIDFPHASMNAPTTCLAIEISTDKITNVANALNM
QQNFANDALFEYNPNLVHTQHNTQTQQLLERMVHLFSEQGAERHYLIDLSLNELITRLLQ
QQSRDLLLANCDKLRLKSNVSDALHYIEEHLSENLDINTLCKITCMSRSKFYQQFKLAFG
TSPALWQQQLRLKKARTLLLEGHAISKVCYDLGFNSASHFSRLFKQTFGIAPKACRH
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcacacatctcagttaaataaaaaacgccaacaacttgatgtactgattgaaaacaaa
gtgacctttgctgccgataactctgagctaagtatttacgatacctataaaagtgcgcaa
aaagtggcgttgcactcaaacgaattactgttttgtgccatgctcagtggtaaaaaaata
atgcatgttgagagcagtcaataccacaaagcgtttttaccacatgaatcgtttgtatta
gcgcctgagcaaagcgtgctgattgattttccgcatgcatctatgaacgcacccaccacc
tgtttagccattgaaataagcaccgataaaataaccaatgtggctaatgcgcttaatatg
cagcaaaattttgcaaacgatgccttgtttgaatacaaccctaatttagtgcatacccaa
cataatacgcaaactcagcagttattagagcgcatggtgcatttatttagtgagcaaggc
gctgagcgacactacttaattgatttatcgttaaacgaattgatcacccgtttattacaa
caacaaagccgtgatttattgctggcaaactgcgataagctgcgcctaaaaagtaacgtg
agtgatgcactgcattatattgaagagcatttaagcgaaaacctcgacataaacaccttg
tgcaaaataacctgtatgagccgtagtaagttttaccagcaatttaaacttgcttttggt
acaagccctgcactttggcagcaacaacttaggcttaaaaaagcccgcacgcttttatta
gaaggccacgctataagcaaggtatgctacgacctgggttttaatagcgccagtcatttt
agccgtttgtttaagcaaacttttggtattgcaccaaaagcatgtcgccattaa

DBGET integrated database retrieval system