KEGG   Pseudoalteromonas sp. SM9913: PSM_B0267
Entry
PSM_B0267         CDS       T01374                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase B (wide specificity)
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00010  Glycolysis / Gluconeogenesis
psm00620  Pyruvate metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_B0267 (aldB)
   00620 Pyruvate metabolism
    PSM_B0267 (aldB)
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     PSM_B0267 (aldB)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: ADT70307
Position
II:301684..303204
AA seq 506 aa
MIYANPGTADALVTFKQQYGNYIGGEWVAPVNGQYFDNISPVNGKVFCKVPRSDKDDINL
ALDKAHAVKTQWGTTSVAERSNILLKIADRIEQNLELLAVAETWDNGKAIRETLAADIPL
AADHFRYFAGCLRAQEGSIGEIDETTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVILKPAEQTPASILVLMEIIGDLLPGGVLNVVNGFGKEAGEALATSTRIAKIAFTG
STPVGSHILKCAAENIIPSTVELGGKSPNIFFSDVMEKDDSYLDKAIEGAILAYFNQGEV
CTCPSRLFIQEDIYEQFIERILKRTKQIKRGNPLDSETMVGAQASKAQFDKILSYIEIGK
EEGAEVLTGGHVEQLSDELNGGYYIQPTLLKGRNDMRVFQEEIFGPVISMSTFKDEAEAL
ELANSSEFGLGAGVWSRNMNRAYHFGRKIEAGRVWTNCYHMYPAHAAFGGYKKSGIGRET
HKLALDHYQQTKNLLVSYSEDPLGFF
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgatttacgcaaatccaggcacagcagacgcactcgtcacatttaaacagcagtatggt
aattacattggcggcgagtgggttgccccagttaacggccagtactttgataatataagc
ccagttaatggcaaggtattttgtaaagtaccgcgctcagacaaagacgatataaacctt
gcactcgacaaagcccatgcagtaaaaacccagtggggcactacctcagtcgccgagcgc
agcaatatactattaaaaattgccgaccgtattgaacaaaacttggagctacttgcagtg
gccgaaacatgggataacggcaaagcgattcgtgaaacccttgccgctgatattccactg
gccgccgatcactttcgttactttgccggttgtttgcgtgctcaagagggcagtattggc
gagatagacgaaactacggtggcgtatcattttcatgagcctctaggcgttgtagggcaa
attattccgtggaacttcccattattaatggccgcatggaaattagcgcctgcacttgca
gcaggtaactgtgtaatattaaaacccgcagagcaaacacccgcctcaatcttagtgttg
atggaaattattggcgatttactgccagggggtgttttaaatgtggtaaacggctttggt
aaagaagctggtgaagcactggcaactagtacgcgcattgctaaaattgcctttacaggc
tcaactcctgtgggctcacatattttaaaatgtgcagccgagaatattattccttcaacg
gtcgagcttggggggaaatcgcctaatatcttctttagcgatgttatggaaaaagacgac
tcatatttagataaggcaattgagggtgccattcttgcctactttaaccaaggtgaagta
tgtacttgtccatcacgcttgttcattcaagaagatatttatgagcaatttatagaacgt
attttaaaacgtactaaacaaattaaacgtggcaacccgcttgatagtgaaaccatggta
ggcgctcaagcctctaaagcgcagtttgataaaattttaagctacattgaaattggtaaa
gaagaaggtgctgaagtattaactggcggccatgttgagcaattaagcgacgagctaaac
ggcgggtattacattcaacctacactattaaaaggacgtaatgacatgcgcgtgttccaa
gaagaaatttttggccccgttatttcaatgtcgacctttaaagacgaagccgaagcactt
gaactggctaacagctcagaatttggtttaggcgcaggggtatggagccgtaatatgaat
cgtgcttatcactttggtcgcaaaatagaagcaggtcgtgtatggactaattgttaccat
atgtacccagcacatgcagcgtttggcggttataaaaagtctggtataggccgcgaaact
cacaaactcgcgcttgatcattaccaacaaactaaaaacttgctagtaagttacagcgaa
gatccgcttggctttttttaa

DBGET integrated database retrieval system