KEGG   Pseudoalteromonas sp. SM9913: PSM_B0269
Entry
PSM_B0269         CDS       T01374                                 

Definition
(GenBank) CBS domain-containing protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DUF998 DUF2371
Other DBs
NCBI-ProteinID: ADT70309
Position
II:303508..304113
AA seq 201 aa
MFETIAIYSGLIATLWIFIGVYVASRFYEGYSHSKQFCSELGATGSPTEKLSPLINNYPL
GFLFCFFGWYLAQLANVSILVNIVGWLVIVHGIGTWVAGYFPMDADPFTKHPTFSCKVQS
WAGFIMLLSLVVAPILIAISPTTEITPLYFRVFSIVSVIATVYYLFAMAKAIKLQSNPGS
YQRISYGIQLSWLSVFSIVLM
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtttgaaacgattgcgatttattcagggttaatagccacattatggatattcattggt
gtttatgtagcaagtcggttttatgaaggttacagtcattctaaacaattttgtagtgaa
ttaggtgcaacgggaagcccaactgaaaaactgtcaccgctaattaataattatccttta
ggttttctattttgcttttttggctggtatttggcgcaattggctaatgtttctatattg
gttaatattgttggttggttagttatagtgcatggtattggtacctgggttgcgggttat
tttcctatggatgctgacccatttactaaacatccaacttttagctgcaaggttcaatct
tgggctggttttattatgttactttcgctggttgtagcaccaatattaatagcgatcagt
ccaaccacagaaattactcctttatactttcgtgttttttcaattgtttctgttatcgct
actgtttattatctgtttgctatggctaaagcaataaaactacaaagtaaccctggtagc
tatcaacgtatctcttatggtatccaattaagttggttaagtgttttttcaatagtgtta
atgtaa

DBGET integrated database retrieval system