KEGG   Pseudoalteromonas sp. SM9913: PSM_B0270
Entry
PSM_B0270         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70310
Position
II:304218..304436
AA seq 72 aa
MNINHTKFRFILLKGVLGWGIPTAILFQLIMYFTGEQDFFDGIISSLIIFPLVGILFGYF
LWHSKYKKERNN
NT seq 219 nt   +upstreamnt  +downstreamnt
atgaatataaaccacactaaattccgttttattttactaaaaggtgttctaggctgggga
attcctacagctattttatttcaattaattatgtactttacaggtgagcaagattttttt
gatggaatcatttcatctttaataatatttcctttagtaggcatattatttggatacttt
ttgtggcattcgaaatataaaaaagagcgaaataactga

DBGET integrated database retrieval system