KEGG   Pseudoalteromonas sp. SM9913: PSM_B0272
Entry
PSM_B0272         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70312
Position
II:305106..305237
AA seq 43 aa
MDIDSHIVQLEKNNRKLFSASHYLGLTIAMAVIVLLLMFYSAH
NT seq 132 nt   +upstreamnt  +downstreamnt
atggatatagattctcatatagttcaacttgaaaaaaacaaccgaaagttatttagtgca
tctcattatttggggcttacgatagcgatggctgttattgttttgttgttaatgttttat
tcagcccattga

DBGET integrated database retrieval system