KEGG   Pseudoalteromonas sp. SM9913: PSM_B0273
Entry
PSM_B0273         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Peptidase_S41 DUP
Other DBs
NCBI-ProteinID: ADT70313
Position
II:305541..307013
AA seq 490 aa
MNIKTKIVSRTLLSALLITPTLSMAELAVTPQTPEQWRSVTDRDIEAAYSISAKNHPGMF
DVNNPVFPELLKQAKAEALALSAKASGPQVHVAAIARFSTVLQDGHAGVFSSVERPARRW
PGFSAVWRGDALKVYYSETDNINKGDVISGCDRQSTETLMRQRVFKFHGQVTQPGHWWQQ
GWRLLIDEGNPFLTPLKECQFVKANGQAYSKTLDWSVRPKSVSKHLTHAYNGDELTTDLT
WPAQNIAWIAMPSFANNDKQTHDYNNLYKKVTDQRSKLLSAKTVVLDLRHNQGGSSYWSL
KLAKALWGEQVVEQKMDNYSKNSRVWWRASKDNTSHVKSLIEVLKDQPKAQKEFKEIAAG
MAQSLENNKLFYIEEPQSKPNQSDSTVPESDFKTQVFVIVPPQCASACLDAIDVFKQFSN
TQLFGAPSSADSLYMDVRLAELPSGLGKVIVPNKVYVNRARGKGDYYKPDIAYNDIDWTT
DKLLEKIKQL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaacataaaaacaaaaatagttagccgtactttattgagtgctttattaattacgcct
accttgagcatggcagaattagcagttactcctcaaacaccagagcaatggcgcagtgtt
actgatcgtgatattgaagctgcttacagtatttcggcaaaaaaccaccccggtatgttt
gatgttaacaacccagtctttcctgagctattaaagcaagcaaaagcagaagcacttgca
ctgtctgccaaagcgagcgggccgcaggttcatgttgcggcaattgcgcgttttagtact
gtgctacaagatggtcatgcaggtgtgttttcaagcgttgaacgacctgctcgtcgttgg
ccaggttttagtgccgtttggcggggtgatgcattaaaagtgtattacagtgaaacagat
aatataaataaaggtgatgtgataagtggttgcgataggcaaagtaccgagacgttaatg
cgacaaagagtgtttaaatttcatggacaggttacacaacctgggcattggtggcagcaa
ggttggcggttactaattgatgagggcaacccatttttaacacctctaaaagaatgtcaa
tttgttaaagccaatgggcaagcttacagtaaaacccttgattggtctgttcggccaaag
agtgtaagtaagcatttaacacatgcctataatggggatgagcttacaaccgatttaact
tggcctgcgcaaaacatagcgtggattgctatgcccagttttgcaaataacgataagcaa
actcatgattacaataacttgtataaaaaagtgactgatcaacgttctaagttactcagt
gcaaaaacggtggttttagatcttcgtcataaccaaggtggctcgtcgtattggagctta
aagcttgcaaaagcgttgtggggtgagcaagttgttgaacaaaaaatggataactactca
aaaaatagccgagtttggtggagagcgtcaaaagataatactagccatgttaaatcatta
attgaagtgttgaaagatcaacctaaagcacaaaaagagtttaaagaaatagctgcaggt
atggcgcagtcacttgaaaataataagctattttacatcgaagagccgcaaagtaaacca
aaccaaagcgatagcacggtgccagagagtgactttaaaacacaggtttttgttattgtg
ccgccacagtgtgcaagtgcgtgtcttgatgccattgatgtatttaagcagttttcaaac
actcagttatttggcgcgccaagcagtgctgactcactgtatatggatgttcgattagct
gagttaccctcaggtttaggtaaagtgatagtgcctaataaagtgtatgtgaatagagca
agaggaaagggcgattattataaacccgatattgcctataacgatattgattggacaacc
gataagctattagaaaaaattaaacagttataa

DBGET integrated database retrieval system