KEGG   Pseudoalteromonas sp. SM9913: PSM_B0274
Entry
PSM_B0274         CDS       T01374                                 

Definition
(GenBank) Nucleoside diphosphate kinase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-ProteinID: ADT70314
Position
II:complement(307087..310080)
AA seq 997 aa
MNTNKFKKSPLAASVSLIIAASTFNFAYAAQENTAEPELEVIEVKGIRGSLIRSMDVKRD
ASGVVDAISAEEMGKFPDTNLAESLQRITGVSVSRSNGEGSQITVRGFGPSFNLVTLNGR
QMAGTGFTRSFNFENLSSEGVSSLEVMKTARADTPTGGLGATVNIVTAKPLQKPGQRFSL
MAKGIHDTSVEEGDEVTPEIAGIYSNTFADEMFGFSANFSYHRRDFQRQAANVRSWLVNP
NLSVDAENIIDNRPMDADGNPAKQFFDPNAGDNGEFVSAAFFPQEVSFSKDDIQRERLNA
QATFQFAPTDNLTFTLDHTISNATTGNNSLSWGIWNGSFGGNGNAYELDENGTAIYYNSA
GDDASFTAFRETAEVDSKATGINVEWLATENLSFNFDAHTSKTTTDNGKDPGLNSNARII
LGSAELSTKEYFFREGDVPGFNINWNNGTQEVSPNQIGSNFSIFTRTPGESEVSQVQLDG
KLFTYTDIGLETVKFGAAYTKQTLSGWGGSNNANAPGFNNGTFAEIFPDAMFERIDLSGF
LDEFSFGPNGVAPGYAYTYDLDEAFARQSAYLTEDVIGSDYYRIGSFDNFPTNEVEEETI
SVYLSSNWVFNVSDYDVFVNLGLRYEETDIVSPAKSRVAEQVYWAGGSEWLTQFAAGGEL
VEVDYEGQYDLLLPMIDIKVDLTDDLVTRASWGQTITRPTLGNMLGNLALTPSPKLNSRS
GSRGNPNLEPFKSTNLDLSLEYYYSEGSYAAVGLFWKDVDNWIDNTQVKTTFEGLHDVYL
GERWNNAVAAIEGRGDQATDTAIYNEIVANGVGIGENNRILPDPATDPLIEWTINSPENV
GSRKVNGFEFAVQHLFGDSGFGAGFNATVVDGDVEYDNYYLASQAVLAGLSDSANIQGFY
EKDGLSVKITGAWRDEYLIAQGLPDSGATAPPQYAEEYLQWDISVNYEVNESTTVFFEGV
NLTNETERSFSRFESQFLSAAQYGPRYAFGVRYSMGN
NT seq 2994 nt   +upstreamnt  +downstreamnt
atgaacacaaataagtttaaaaaaagcccactagcggcttctgtgtcacttatcatcgct
gcaagcacatttaacttcgcttatgctgcgcaagaaaatactgccgaacctgaactagaa
gttattgaagtaaaaggtattcgtggttcattaatccgttcaatggatgtaaagcgtgac
gcatcaggcgtggttgatgccatttctgctgaagaaatgggtaaatttccagatactaat
ttagctgaatcgctacaacgtattacgggtgtatcggtaagtcgctcaaacggtgaaggt
agccaaattaccgtacgtggttttggcccatcgtttaaccttgtaacacttaacggccgt
caaatggcaggcaccggttttacgcgttcatttaactttgagaacttatcatctgaaggc
gttagttcacttgaagttatgaaaacagcgcgtgcggatacaccaacaggtggccttggt
gcaactgtaaatattgttaccgctaaacctctacaaaagccgggtcagcgcttttcattg
atggctaaaggcattcacgatacatcggtagaagaaggtgatgaagtaacacctgaaatt
gcaggtatttacagcaatacttttgctgacgaaatgtttggtttttcagctaacttttca
taccaccgccgtgattttcagcgccaagcagccaatgtacgctcttggttagtcaaccct
aacctatcggttgatgctgaaaacataattgataaccgcccaatggatgcagatggtaac
ccagctaagcagtttttcgatccaaatgctggggataatggtgagtttgtatctgccgct
ttcttcccacaagaagtcagcttttcaaaagatgatattcagcgtgaacgtttaaatgcg
caagccacttttcagtttgcaccaacagataacttaacgtttacactagatcacacaatc
tcaaatgcaacaacaggtaataactcactatcgtggggtatttggaacggttcgtttggt
ggtaatggtaatgcctatgagctagatgaaaatggcaccgctatttactataactcagcc
ggtgatgatgcctcattcacggcatttcgtgaaactgccgaggtagactcaaaagcaacc
ggtatcaatgttgaatggttagcaacagaaaaccttagttttaactttgatgcccatact
tcaaaaaccacaacagataatggcaaagatcctggcttaaattctaatgcccgtattatt
ttgggctcagcagagttatctactaaagaatactttttccgcgaaggcgatgtaccgggt
tttaatattaattggaacaacggcacacaagaagtaagtccaaatcaaattggttctaac
ttcagtatttttaccagaacaccaggtgagtcagaagtttctcaagtacaattagacggt
aaattatttacttatacagatattggtcttgaaaccgttaaatttggtgcggcttacact
aagcaaacactcagtggttggggcggctctaataacgccaatgcacctggctttaacaac
ggtacattcgctgaaattttcccagatgcgatgttcgaaaggattgatttaagcggattc
cttgatgaattttcatttggtcctaacggcgtagcgccaggttatgcttacacttatgac
cttgatgaagcatttgctcgtcaaagtgcttatttgaccgaagacgtaattggtagtgat
tattaccgaattggtagctttgataacttcccaactaacgaagtagaagaagaaaccatt
agtgtttacctttctagcaactgggtatttaacgttagcgactacgacgtatttgtaaac
ttaggtcttcgttatgaagaaactgatattgtaagcccagcaaaaagtcgtgtagcggaa
caagtttactgggcaggcggttcagagtggttaactcaatttgccgctggtggcgaatta
gttgaagtagactatgaaggacaatacgacttactacttcctatgattgatattaaagtc
gatcttacggatgacttagtaacccgcgcatcatggggacaaacaatcaccagaccaact
cttggcaatatgttaggtaacttggctttaacaccatcacctaaattaaattcaagaagt
ggtagccgtggtaatccaaacttagagccatttaaatcaactaatctagatttaagcctt
gagtattattacagcgaaggcagttacgctgctgttggtctattttggaaagacgtagat
aattggattgataacacccaggtaaaaactacctttgaaggtttacatgatgtgtattta
ggtgagcgttggaacaatgcagtagccgccattgaaggtcgtggagatcaagcaactgac
actgcaatttacaatgaaattgtagctaatggcgtaggcattggtgaaaacaaccgtata
ttaccagatccagcgactgatccgctgattgaatggaccatcaattcacctgaaaacgtt
ggttcacgtaaagtaaacggttttgaatttgctgttcagcacttgtttggcgactcaggc
tttggtgcaggctttaatgccaccgttgttgatggtgatgtagagtacgataactactac
cttgcctctcaagcagtattagctggtttaagtgattctgcaaacatacaaggcttttac
gaaaaagatggcttatcggtgaaaattaccggtgcatggcgtgatgagtacttaattgcg
caaggtttacctgactcaggtgctacggctcctccacaatacgcagaagagtacttacag
tgggatattagtgtgaactacgaagttaacgaaagcacaacggtattctttgaaggtgtg
aacttaaccaacgaaaccgagcgttcattcagtcgcttcgaaagtcagttcttaagcgcg
gctcaatacggccctcgttatgcctttggcgttagatactctatgggcaattaa

DBGET integrated database retrieval system