KEGG   Pseudoalteromonas sp. SM9913: PSM_B0276
Entry
PSM_B0276         CDS       T01374                                 

Definition
(GenBank) putative C-5 sterol desaturase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-ProteinID: ADT70316
Position
II:complement(313084..313872)
AA seq 262 aa
MDNELWWRLGCFVSILVIMMLLEWQAPARQSPIKATKRWVANFGLVFTSSVIARLAVPLG
LTAAALYNQEHSIGVFNQLTMPLSVAIILSLLLLDILIYWQHRLFHKIPILWRLHRVHHA
DAHVDTSTGLRFHPIEIGLSILIKLAAITALGVPAIAVLIFEITLNGLALFNHANIRLPS
AIEKPLRLILITQALHRIHHSQNPEETNSNFGFSVTWWDRLFGSYKSQASQPDKRIALGL
SQYPNPEQNSSLWQLLIMPFKK
NT seq 789 nt   +upstreamnt  +downstreamnt
atggataacgaattatggtggcggcttggatgttttgtaagtattttagtcataatgatg
ctgcttgagtggcaagcccctgcacggcaatcgcccataaaagccactaaacgttgggtt
gcgaattttggtcttgtatttacctcttcagtgattgctcggttagcggttcctttaggg
ttaaccgccgccgcgctttataaccaagaacatagtatcggtgtgtttaatcaactaact
atgcctctttcagtagcaattatacttagcctgctgttgctagatatactgatttattgg
caacacagattatttcataaaattccaattttatggcgtttacaccgtgttcaccatgct
gatgcgcacgtagatacaagcactgggctgcgctttcaccctattgaaataggtcttagc
atattgataaagcttgccgccataactgctcttggcgtgcccgccattgcagtacttata
tttgaaataacactcaatgggttagcactgtttaaccacgcaaatattcgcttgccaagc
gcaatagaaaaaccactgcgcctcatccttatcacccaagcgctgcaccgcatacatcac
agccaaaaccccgaagaaacaaacagtaactttgggtttagtgtaacttggtgggataga
ctttttggcagctataaatcacaggcaagccagcctgataaacgtattgcacttggtttg
agccaatacccaaaccccgaacaaaattcatccttgtggcaattgttaataatgccattt
aaaaaatag

DBGET integrated database retrieval system