KEGG   Pseudoalteromonas sp. SM9913: PSM_B0277
Entry
PSM_B0277         CDS       T01374                                 

Definition
(GenBank) putative CDP-alcohol phosphatidyltransferase or phosphatidylglycerophosphate synthase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-ProteinID: ADT70317
Position
II:complement(313865..314515)
AA seq 216 aa
MLDKFVTPIIKPLLTPVVMLINKSGITANQLTVFGFLVGMFAVPLLAFEMWYGALIAIAL
NRILDGLDGALARYANQSSSAGGFLDITLDFLFYAAIPLGFILANPAQNAIAGAILLATF
IGTGSSFLAFAIAAEKFKLDKPQFKYKSFYYLNGLTEGTETIALFVAFCIWPQHFAIMAS
LFAAACAITIFTRIYGGYHTLKQLEANISKTEAING
NT seq 651 nt   +upstreamnt  +downstreamnt
atgttagataaatttgttacccccattataaagccactactaacaccggttgttatgctc
attaataaaagcggcattacagctaatcaactcactgtttttggttttttagtgggtatg
tttgccgtgcctttacttgcctttgaaatgtggtatggcgcattaatcgccattgcgttg
aatagaattttagatggactggatggcgcattagcccgctatgctaatcaaagttctagc
gcgggtgggtttttagatattactctcgactttttattttacgcagcgattccactgggc
tttattttggctaatccagcacaaaatgccattgcaggtgctattttactggctactttt
ataggtaccggttccagctttttggcctttgcgattgccgctgaaaaatttaaactcgac
aaaccacaatttaaatataaaagtttttactacttaaatggcttaaccgaaggcacagaa
accattgccttatttgttgccttttgtatttggccgcagcactttgccataatggccagc
ttatttgctgcagcttgcgccataacgattttcacccgtatttatggcggttatcacaca
ttaaaacaactagaagctaatatcagtaaaacggaggctatcaatggataa

DBGET integrated database retrieval system