KEGG   Pseudoalteromonas sp. SM9913: PSM_B0278
Entry
PSM_B0278         CDS       T01374                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K05779  putative thiamine transport system ATP-binding protein
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0278
Transporters [BR:psm02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative thiamine transporter
    PSM_B0278
SSDB
Motif
Pfam: ABC_tran RsgA_GTPase AAA_16 SMC_N AAA_22 AAA_23 AAA_29 AAA_33 SbcCD_C Rad17 MMR_HSR1 Mg_chelatase NACHT Adeno_IVa2
Other DBs
NCBI-ProteinID: ADT70318
Position
II:complement(314544..315182)
AA seq 212 aa
MQSSLHIKDCQLYRQGELLLSLNEQVNGGEILTIMGPSGSGKSSLLNWLTGCLPKDFRAQ
GEVWLNDQNIDNTPPHLRHIGVLYQDALLFSHLTVAGNIAFAMPKGNKKQRLEKIDHALE
QVGLTGLAARHPDSLSGGQQARVALLRMLLSEPKAILLDEPFSKLDTQLRVDTRELVFSQ
IREHKLPAIMVTHDHSDAEATAGKVITLGTDA
NT seq 639 nt   +upstreamnt  +downstreamnt
atgcagtcatcattacacatcaaagattgtcagctttaccgtcaaggcgagctgttacta
agcttaaacgagcaagtaaatggcggcgaaatactcaccattatggggccatcgggcagt
ggcaagtcaagcttattaaattggcttacaggctgtttgcccaaagactttagggcacaa
ggcgaagtatggctaaatgatcaaaatatagataacacacccccgcatttacgccatatt
ggggtgctctaccaagacgctttattgttttcgcatttaacagtggcaggaaatattgcc
tttgctatgcccaaaggcaataaaaagcagcgtcttgaaaaaatagaccacgccctagaa
caagttggcttaacaggattggcagcccgccatcccgacagtctatctggtgggcagcaa
gcgcgtgttgcactgctacgcatgttgctcagcgaacctaaagctattttactcgacgag
ccttttagtaaactcgacacccaattgcgtgttgatacccgcgaactggtgtttagtcaa
atacgcgagcataaattgcctgccattatggttacgcacgaccacagtgacgccgaggca
acagctggcaaagtgattactttaggcactgatgcttaa

DBGET integrated database retrieval system