KEGG   Pseudoalteromonas sp. SM9913: PSM_B0279
Entry
PSM_B0279         CDS       T01374                                 

Definition
(GenBank) putative ABC-type transport system, permease component
  KO
K05778  putative thiamine transport system permease protein
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0279
Transporters [BR:psm02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative thiamine transporter
    PSM_B0279
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: ADT70319
Position
II:complement(315207..316922)
AA seq 571 aa
MNKVPASNSLFTFLVKLSPYCLVALLTLPVLGGVIGVLLPAFGWAPALNETNIGLAGFNA
LWQTPGLTHMVELSIRTGLISTLIAFVLMIIMLGAFFNSVWLKRIEYILSPILVIPHAAA
AIAVSFLIAPSGLFTRLFSPWLTGWQLAPEGALPYDAFGWSIIIGLVLKELPFLLLIALS
VLAQPELGKKLRKQHQIAVNLGYYPMVAFFKVVLPSLYPLLRLPIFAVLAYASASVEMPL
ILGPNTPPTLAVAIMHWFNDVDLNLRIKASAGALLQLAVTVGLLLTWLLLEKIIALVFKQ
SLINGRRQYAHQLICTFTHVFTSLILIFIVAALIGLVMWSIAGYWRFPDTVPSSVVFLHF
QHAFTQIHTPLFNTLIIGVISTLFAITMVLLCLEAEQLNTKPMSKWTQLIIYLPLLVPSI
AFLFGIVWLQQLLNSQHAFFNVIFVHVLFVLPYVFLSIADSYRRLDPRLARVAASLGTSP
CKVFLQVKLPQLFAPILIAIALGLAISFGQYLSTLLASGGRISTITTEAVTLANGASRRT
SAVYAILQMALPLIGFGVAWVLPKYFFKARA
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgaataaagtacccgcttcaaatagcctatttacctttttggtcaaactaagtccttac
tgtttggttgcattgcttactttacccgttttagggggggtaatcggcgtgcttttacct
gcctttggttgggcgccggcactcaatgaaacaaatattggcttagcaggatttaacgca
ttatggcaaacgcctggattgacacacatggtagagctgagcatacgaacagggcttatt
agtaccttaatcgcgtttgtgctgatgatcattatgcttggcgcgttttttaatagtgtg
tggcttaaacgcattgaatatattttaagtccaatattggttattccgcatgccgctgcc
gcgattgcggtgagttttttaattgcgccatcggggttatttactcgtttattttctcca
tggttaactggctggcaattagcgccagaaggcgcgttaccttacgacgcttttggctgg
agcattattattgggcttgtgcttaaagagttaccttttttactactgattgcattgagt
gttttggcgcaacccgaacttggcaaaaagctacgcaaacagcatcaaattgcggttaat
ttaggttattaccctatggtggcgttttttaaagtggtgctacccagtttatacccactg
ttacgtttacctatttttgcagtacttgcttatgccagcgccagcgttgaaatgccactc
attcttggcccaaatacccctcccactttagccgttgctataatgcactggtttaacgat
gtagatttaaacctgcgaataaaagcctcggcgggtgccctgttacaattagcggtcact
gttggactactcttaacgtggctattgcttgaaaaaatcattgctctagtttttaagcaa
tcacttattaatggccgccgccagtatgcacatcaattgatctgcacatttactcatgtt
ttcacgagtctaattttaatttttattgttgctgcgctaattgggttagtgatgtggtca
atagcgggctattggcgttttccggataccgtgccctcaagcgtggtatttctgcatttt
caacatgcatttacacaaatacatactcccttgtttaataccttaataataggggtaata
agtacgctgtttgctatcactatggtattgctgtgcttagaagccgagcagttaaacacg
aaacccatgtcgaaatggacacagttaattatttatcttcctttattagtgcccagtatt
gcgtttttatttggtattgtgtggttacaacaactgctcaatagccagcatgcctttttt
aatgtgatatttgtgcacgttttatttgttttaccgtatgtttttttatctattgccgat
agttacaggcgtttagaccctcgattagcgcgcgttgccgcaagcttggggacaagtccc
tgcaaggtgtttttacaggttaaattgccacaactattcgcccctattttaatcgcgata
gcgcttggactggcgattagttttggccaatatttatctacacttttagccagtggcggg
cgtataagtaccattaccaccgaagccgtaacccttgctaatggcgcaagcagacgcacc
agtgcagtttacgccattttacaaatggcattaccgctaattggttttggtgtggcatgg
gtgttacctaaatacttttttaaagcgcgcgcttaa

DBGET integrated database retrieval system