KEGG   Pseudoalteromonas sp. SM9913: PSM_B0280
Entry
PSM_B0280         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
  KO
K05777  putative thiamine transport system substrate-binding protein
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0280
Transporters [BR:psm02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative thiamine transporter
    PSM_B0280
SSDB
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6
Other DBs
NCBI-ProteinID: ADT70320
Position
II:complement(316919..318196)
AA seq 425 aa
MHVVKPIQILSRYCFLSIALCIVLVASFKTMATSPSDTRWQTIQSQGKNQPVYFYAWGGD
PQINAYIQWVAEQVKAQYDIELVHVKLSDTSEAVSRVLAEKSANNHAQGSVDLIWINGAN
FAAMSKHDLLLKDWAQTLPNFALTDPNNNPAVNFDFGLPTNGMEAPWGQASLTFYYDSLA
IDGSTTNQLPTTLHQLLTWSAQNPGRFSYPKPPDFLGMSFLKYALVVLHNNNDDELKAQL
NQPATDKNTTEVLNPLWVFLNKLHPTLWRSGKHFMQSGAQMRRLIDDTELSIGFTFSAPE
VPAAVQRFDLPTSTRSYAMHDGSLSNTHFVAIPYNASHAQGAQLVANFLLSPQAQAHKQK
PTIWGDKTVLIQSMLNTQQQALFKTTQPHPSALPFNSIKRTLSEPHPSWVNAIMQGWQTR
YGVSQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcacgtcgttaagccaatacaaatactcagccgatattgttttttgagtattgctttg
tgcattgttttagttgctagctttaaaaccatggcaacctctccctctgatactcgctgg
caaactatccaaagccaaggtaaaaaccaacccgtttatttttatgcatggggcggcgat
ccgcaaataaatgcctacattcaatgggtggctgagcaggtcaaagcgcaatatgatatt
gaattagtgcatgtaaaattaagcgataccagcgaagcagtaagccgagtattagcagaa
aaatcagccaataatcacgctcaaggcagtgtcgatttaatttggatcaatggcgctaac
tttgccgctatgagtaagcatgacttgctgcttaaagactgggcccagacgctgccaaat
tttgcattaaccgatcctaataataaccccgcggtaaactttgattttggtttgcctaca
aacgggatggaagcgccttgggggcaagcgtcgctcactttttattacgacagcctagca
atagatggcagcacaacgaatcaattacccaccaccctacatcagttattaacttggagc
gcgcaaaaccctgggcgttttagttacccaaagccgcctgattttttaggcatgagcttt
ttaaaatacgctttagtggtactacataacaacaacgatgatgaattaaaagcacagcta
aaccagccagctacagataaaaacaccactgaggtgctcaaccctttgtgggtattttta
aataaattacaccctacgctttggcgtagcggcaaacattttatgcaaagtggcgcacaa
atgcgccgcttaattgacgatactgagcttagtatcgggtttaccttttcagcgccagaa
gtgcccgctgcagtacaacgctttgatttacccaccagcacccgcagttatgctatgcat
gatggcagtttaagtaacacccattttgtagcaataccgtataatgcaagccatgcacaa
ggcgcacagttagtcgctaattttttattaagccctcaagcgcaagctcataaacaaaag
cccactatttggggcgataaaaccgtgttgatccaatcaatgctaaatacccagcaacaa
gccttatttaaaaccacacaaccgcacccaagtgcgctgccttttaatagcataaaacgc
acactcagtgagcctcacccaagttgggttaatgccataatgcaaggttggcaaacgcgc
tatggggttagccaatga

DBGET integrated database retrieval system