KEGG   Pseudoalteromonas sp. SM9913: PSM_B0281
Entry
PSM_B0281         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DUF547
Other DBs
NCBI-ProteinID: ADT70321
Position
II:complement(318183..319007)
AA seq 274 aa
MHGAEVKPLYTLLKFLVLSALLVTAFKSSAQNLHDSWNTLLTKHVVAINHGHSTEVDYAA
IKHEHTQLKAYLNTLTAITPGEFNTWGKHKQLAFLINAYNAFTVELILTQYPNIESIKEL
GSFFSSPWSKEFISLLGKTRSLDDIEHELIRGSGKYNDPRIHFAVNCASIGCPALREEAY
SADKLEEQLHQQTVRFLSDNTRNMATGNTLNVSSIFKWYGGDFEQGFKGANTLHPFLAQY
ADALKLLPAQQKALQNNDMKIKFLDYNWNLNARR
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcatggcgccgaggttaagcctttgtatacgttattgaagtttttagttttaagtgca
ctactggtcacggcgtttaaaagtagtgcacaaaacctgcacgatagttggaacacgcta
ttaactaaacatgttgtcgctattaatcatgggcacagcactgaggttgattacgctgca
attaaacacgagcatacccaattaaaagcatatttaaatacgttaacagccatcacacca
ggtgaatttaacacgtggggtaaacacaaacagttggcgtttttaattaatgcctataat
gcctttaccgttgaactaatattaacgcagtaccctaatattgaatcaatcaaagagtta
ggtagcttttttagttcaccgtggagcaaagagtttatttcgctgctaggtaaaacacgc
agccttgatgatatagagcatgagttaattcgtggtagtggtaaatacaacgacccgcgt
attcactttgcagtaaactgcgccagtattggttgccctgcacttcgtgaagaagcctac
tcggccgataaactagaagagcaattacaccagcaaactgttcgttttttgtcagacaac
acccgcaacatggcaacaggcaatactttaaatgtatcgtctatttttaaatggtacggc
ggtgattttgaacaaggctttaaaggagcaaacacattacacccgtttttagcacaatac
gctgatgcattaaaactgctacccgctcaacaaaaagcgctgcaaaataatgacatgaaa
attaaatttttagattacaactggaatttaaatgcacgtcgttaa

DBGET integrated database retrieval system