KEGG   Pseudoalteromonas sp. SM9913: PSM_B0282
Entry
PSM_B0282         CDS       T01374                                 

Definition
(GenBank) mercuric reductase (Hg(II) reductase)
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim SNARE_assoc Pyr_redox Pyr_redox_3 GIDA K_oxygenase NAD_binding_8 HI0933_like DAO AlaDh_PNT_C Lycopene_cycl 3HCDH_N FAD_oxidored Thi4 EptA_B_N 2-Hacid_dh_C PRMT5 ThiF FAD_binding_2
Other DBs
NCBI-ProteinID: ADT70322
Position
II:complement(318988..321093)
AA seq 701 aa
MFFHFNLHQLLTLDGLKGSMDQFNQYKAQSPLLVIGGFFLLYVVVTALSLPGAAILTLAA
GALFGLVEGLLVASFASTIGATLAFLVSRYLLRDTIKKRFPERLAAIDKGVDKEGAFYLF
TLRLVPVFPFFLINLLMGLTAIKSWTFYWVSQIGMLAGTFVFVNAGTQLAQIERLSGILS
LDLILSFALLGVFPLIAKAILNVFKKQRVYKNYTKPKKFDRNMIVIGAGAGGLVTSYIAA
AVKAKVTLIEAGEMGGDCLNTGCVPSKAIIKSAKIAQQMRHGENYGLENTTPQFSFKKVM
ARVHQVIADIAPHDSIERYTNLGVEVLKGYGKLIDPWTVEIKLNDGSTQTLTARTLVIAT
GARPFIPPLPGIEETGYVTSDTLWSKFAELDEAPKKLVVLGGGPIGCELAQSFARLGSSV
TQVEMTQRVMIKEDVEVSAFAHQSLADSGVNILTSHQALRCEAREGKKYLVVKHNDTEID
IEYDELLCAVGRSAHLKGYGLEELGIETNRTIVTNDYLETLYPNIFAAGDIVGPYQFTHV
AAHQGWYAAVNGLFGHFKKFKVDYRVIPWTTFIDPEVARVGLNEQEAIDKGIDYEITRFE
FEELDRAITESANNGFIKVITPKGKDKILGVTVVSEHAGDLIAEFVLAMKHGLGLNKILG
TIHSYPTWAEGNKYAAGEWKRNHAPQTVLNMLEKYHAWRRG
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgttctttcattttaatttgcaccagttacttacactcgatggcttaaaagggtcgatg
gatcagtttaaccaatacaaagcgcaatcgccgttgttagttattggcgggttcttttta
ctctatgtggtagtaacggctctctctttacccggcgcagctattttaacattggccgca
ggcgcattatttggcttagtagaaggcttactggtggcgtcgtttgcctcaacgattggt
gctacccttgcctttttagtgtcacgctatttattacgcgacaccattaaaaaacggttt
cctgagcgtttagctgctatagataaaggcgtagataaagaaggcgctttttaccttttt
actttgcgtttagtaccggtatttccgttctttttaattaacctattaatgggcttaacc
gctattaagtcgtggactttttattgggtgagccaaattggtatgttggcaggcaccttt
gtatttgtgaatgccggtactcaacttgcacaaattgagcgtttatcgggcattttgtca
ctagatttaattctgtcatttgctctattaggtgtattcccactgattgcgaaagcgatt
ttaaatgtatttaaaaaacaacgggtttataaaaactacactaagcccaaaaaattcgac
cgtaacatgattgttattggcgcgggtgcaggcggcttagttaccagctatattgccgcc
gcagtaaaagccaaagtcaccttaattgaagccggcgaaatgggtggtgactgcttaaac
actggctgtgtgcctagtaaagcgattattaaaagtgcaaaaatagcacagcaaatgcgc
catggcgaaaactatggccttgaaaacactacaccgcagttttcctttaaaaaagtaatg
gcacgtgtacatcaagtcattgctgatatagccccgcacgacagcatagagcgctacaca
aatttaggtgtggaggttttaaaaggctatggaaaattgattgacccgtggacagtggaa
attaaacttaacgatggcagcacgcaaactcttaccgctcgcacacttgttattgccacc
ggtgcacgcccgtttataccgccactgccaggtattgaagaaaccggttacgttaccagc
gatactttatggagcaaatttgccgagctcgacgaagcgcccaaaaaactggttgtttta
ggtgggggcccgattggttgtgagcttgcacaaagctttgctcgtttaggctcaagtgtg
acgcaagttgaaatgactcagcgcgttatgatcaaagaagatgttgaagtgtcagctttt
gcacaccaatcattggccgatagtggcgttaatattttaacctcacaccaagcgctgcgc
tgtgaagcacgcgagggtaaaaagtacctcgtggtgaagcacaacgacaccgaaattgat
attgaatatgatgagctactgtgtgccgttggccgaagcgcacacctcaaaggctatggc
cttgaagagcttggtatagaaactaatcgaaccatagtaactaacgactacttagaaaca
ctctaccctaatatttttgccgcaggcgatattgtaggcccgtaccagtttactcacgtt
gcggctcatcaggggtggtacgcggcggttaatggcttatttggccactttaaaaagttt
aaagtagattaccgtgttattccatggaccaccttcattgatccagaagtcgcgcgcgta
ggcctaaacgagcaagaagcgattgataaaggcatagactatgaaatcacccgctttgag
tttgaagagttagaccgcgccattactgagagcgccaataatggctttattaaggtgatc
acccctaaaggaaaagacaaaatactcggagttactgtggtttctgagcatgcaggcgat
ttaattgctgaatttgttttagccatgaaacacggccttggccttaataaaattctaggc
acaattcacagctacccaacatgggcagaaggcaacaaatatgccgctggtgaatggaaa
cgtaaccatgctccacaaactgttttaaacatgcttgaaaaataccatgcatggcgccga
ggttaa

DBGET integrated database retrieval system