KEGG   Pseudoalteromonas sp. SM9913: PSM_B0284
Entry
PSM_B0284         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70324
Position
II:323528..323674
AA seq 48 aa
MYVDGYKRPKGLKITFSNLTILLFIKILKIAALLIDLLNKLNSYLQLL
NT seq 147 nt   +upstreamnt  +downstreamnt
ttgtatgttgatggttataaaagaccgaaaggcttaaaaataactttcagcaatttaaca
atattgttatttattaaaatattaaaaatagctgctttgttaatcgatttattaaacaag
cttaacagctatttacaattattatga

DBGET integrated database retrieval system