KEGG   Pseudoalteromonas sp. SM9913: PSM_B0285
Entry
PSM_B0285         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: DoxX Spec3
Other DBs
NCBI-ProteinID: ADT70325
Position
II:323742..324155
AA seq 137 aa
MTGSMNTDVQNRLQWSLLSLRCGVFIVMVMWTLDKFVNPGHSARIFEHFYGISGSTDTIA
YILGALQLLLVIAFLVGIKKRITYGAIFIMHGLSTLSSYNQYIDGFNNLLFFAAWPMWAA
CFALYLLRDQDVKFTIK
NT seq 414 nt   +upstreamnt  +downstreamnt
atgacaggttcaatgaatactgatgtacaaaatcgtttgcagtggtctttattatcgctt
cggtgtggggtgtttatagtgatggtaatgtggacgctagataaatttgtaaatccgggg
catagcgcccgtatttttgaacatttttatgggatcagtggctctaccgatactattgct
tatattttaggtgcactgcaattattgctagtaatagcatttttggtcggtattaaaaaa
cgtattacttacggtgctatttttataatgcatggtttatctacgctttcttcatataat
caatacattgatggctttaataatttactgttttttgcggcgtggcctatgtgggctgcg
tgttttgcgctttatttattacgcgatcaagacgtaaaatttacgattaaataa

DBGET integrated database retrieval system