KEGG   Pseudoalteromonas sp. SM9913: PSM_B0286
Entry
PSM_B0286         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70326
Position
II:complement(324148..324270)
AA seq 40 aa
MTHSKWVTNRLLRTTELPTLPVYFIGYRLTLITIFFAFII
NT seq 123 nt   +upstreamnt  +downstreamnt
atgacacacagtaaatgggtaactaaccgtttactgcgtacaacagaacttcctacactc
cctgtgtactttattggttataggctaacgcttataaccattttttttgcctttattatt
taa

DBGET integrated database retrieval system