KEGG   Pseudoalteromonas sp. SM9913: PSM_B0287
Entry
PSM_B0287         CDS       T01374                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase A (pseudouridylate synthase, 23S RNA-specific)
  KO
K06177  tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psm03009]
    PSM_B0287
   03016 Transfer RNA biogenesis [BR:psm03016]
    PSM_B0287
Enzymes [BR:psm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     PSM_B0287
    5.4.99.29  23S rRNA pseudouridine746 synthase
     PSM_B0287
Ribosome biogenesis [BR:psm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PSM_B0287
Transfer RNA biogenesis [BR:psm03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    PSM_B0287
SSDB
Motif
Pfam: PseudoU_synth_2
Other DBs
NCBI-ProteinID: ADT70327
Position
II:complement(324515..326206)
AA seq 563 aa
MLTANFTAMSNPASCFTVFDENVDSLALPEQFTFPFYYKPHPLAVVAAQQLQQQLKKLDK
AILDTDDIDAGKMFGVLVVQNQAQQLGFISAYSGQIAGIDEQLNFAPNVALKHIDDAVFS
QQSQIINAINAQITALENSEDYQALEQQLATARKNYEQQLVAKQQAMQVTRKQRKEQRQT
GQEQLNADDFEQLKTTLAGQSIVEKKQLQALKQDWQTQITALEQTQAAMLGEINGLKKRR
KTLSKNLQKKLFAQYQFLNAHGEVTDLNAIFAKLPEHTPPSGAGDCAAPKLLQYAYKHDL
KPVAMAEFWWGAPPKSAIRHHLHYYPSCYSKCQPILGHMLKGLNVEENPLLTNPAKGKDL
TIVYQDDDLLVINKPAEFLSVPGINIDDSVYMRIKTQFPAASGPLIVHRLDMSTSGLLII
ALNKRAHKALQKQFIERTIEKRYVALVAGNITENSGVINLPLVLDFDDKPRQMVCYKTGK
PSLTTWHVLERKNNTTRLQLYPKTGRTHQLRVHCAHQLGLNTPIVGDTHYGEEAERLHLH
AEYLAFTHPISHQRLEFEVAADF
NT seq 1692 nt   +upstreamnt  +downstreamnt
ttgttaactgctaattttactgccatgtcaaaccctgctagctgctttaccgtttttgat
gaaaacgtcgattcccttgctctgcctgagcagtttacatttccattttattataaaccg
caccctttggccgttgtcgctgcacagcaattacaacagcaattaaaaaagctagataag
gctattttagatacggatgatattgatgcgggtaaaatgtttggtgtgctcgtcgttcaa
aatcaggcgcaacaactgggatttattagcgcctattcggggcaaatagcgggcatagat
gagcaactgaattttgcacctaatgtggcacttaaacacatagacgatgctgtatttagt
cagcaaagccaaatcattaacgccattaatgcgcaaattacggcattagaaaacagtgaa
gattatcaagcccttgagcagcaattagctacagcacgtaaaaattatgaacagcaactt
gtagccaaacaacaagccatgcaagtgacccgcaaacagcgaaaagagcaacgccaaact
ggccaagagcaactcaatgccgatgactttgaacaacttaaaacaaccttagctgggcaa
agtattgttgagaaaaaacaactgcaggcattaaagcaagactggcaaacgcaaattaca
gcgcttgagcaaacccaagcagctatgctgggtgaaattaacggattaaaaaagcgccgc
aaaacactctcaaaaaacctacaaaagaaattatttgctcaataccaatttttaaatgca
cacggtgaagtgaccgatctgaatgctatttttgccaaacttcctgagcacactccacct
tcgggagcgggggattgcgccgcccctaaattattacaatatgcatacaagcacgattta
aaaccagtggctatggccgaattttggtggggtgcaccgcctaaatcagcaattaggcat
cacttacattattacccatcgtgttatagcaaatgccaacccattttaggtcatatgcta
aaaggcttaaatgttgaagaaaatccattactaacaaaccctgcaaaaggaaaagactta
actattgtttatcaagacgatgatttactggtaataaacaaacccgcggagtttttatcg
gtgccagggattaatattgatgattcagtgtacatgcgtataaaaactcagttccccgcg
gcttctggcccacttattgtgcatcggttagatatgtcgacctcagggctgttaattatt
gcgcttaataagcgcgcgcataaagcgctgcaaaaacagtttattgaacgcacaattgaa
aagcgttacgttgctttagtggcgggcaatattactgagaatagcggagtgattaattta
cctcttgtgctcgactttgatgataaaccacgccaaatggtgtgttataaaaccggtaaa
ccgtcgttaacaacatggcatgtactggagcgcaaaaacaacaccacccgactgcagtta
taccctaaaacagggcgtacacatcagttacgggtacattgcgctcatcaattaggttta
aataccccgatagttggcgatactcattatggtgaagaggcagagcgcttacatttacat
gccgagtatttagccttcacccaccctatttctcatcaacgtttagaatttgaagtagcc
gctgatttttaa

DBGET integrated database retrieval system