KEGG   Pseudoalteromonas sp. SM9913: PSM_B0289
Entry
PSM_B0289         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: ThrE ThrE_2
Other DBs
NCBI-ProteinID: ADT70329
Position
II:complement(328511..329683)
AA seq 390 aa
MLHKYGTPAYRLEAHLMEVATYLGLKSSFVMSPTSVTFVIWTDGHEDEYTHVARVDPGDH
DLGSLADTDDLVNKMLNDELTLQEVDQQLDIIFDAPNPYNRVITGIAFATSGGAFAMLMG
TSWNDVLWSGLLTFVVYLFVLWSARSKRVAHMLEPLVAIVSAVLACAISVHLDAHINIRL
IVLSAIIVFIPGLALALGLAELAARHLVSGTARVMDSFMLLFKLYFGAFIGIAIGFAIFG
QADFVQPEPLPKWTAWLAIFLLCSSLIVIFRTKFKHAAWSIASGFIAYGTSIGSAMYLDY
TLGTFVGAFSVGVFSNLFNRVANAPASIVAMQGLIVLVPGSKTYIGLNSLIEGQDFVYAE
HIGQQTFLIFMSLVAGLIFANVALPPKKSL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgcttcataagtacggtacaccggcatatcgcttagaagcccatttaatggaagtggcg
acttaccttggtcttaaatcatcgtttgtcatgtcgccaacatcggttacctttgttatt
tggactgatggtcatgaagatgaatacacccatgtagcccgtgtagaccctggcgatcac
gacttaggctcacttgcagataccgatgatctcgttaataaaatgcttaatgatgaatta
acgttgcaagaagttgatcagcaacttgatatcatttttgatgccccaaacccttacaat
agagtgattacaggtattgcctttgctacctctggcggcgcatttgcaatgcttatgggc
accagttggaatgacgtgctgtggtctggtttattaacctttgttgtttatttatttgtg
ctgtggtcggctcgttccaagcgcgttgcccacatgttagaacccttagtggcgattgtt
tcagcggtactggcgtgtgccattagcgttcatttagatgcgcatattaatattcgttta
attgttctgtcggccattattgtgtttattccaggcctagcactggcacttggtttagct
gaactcgcagcgcggcatttagtatctggcacagcacgcgttatggactcgtttatgttg
ctgtttaaactttattttggtgcatttattggtattgctattggctttgctatttttggt
caagctgattttgtacagccagagccactgcctaaatggacagcttggttggctatattt
ttactatgtagcagcttaattgtgatatttagaactaagtttaaacatgctgcttggtct
attgcttcaggatttatagcctacggcaccagtattggctctgccatgtatttagattac
acgctaggtacctttgttggcgcattttcagtgggcgtatttagtaacttatttaatcga
gttgctaatgcccctgcttccattgtagctatgcaaggcttaattgtgttggtaccgggg
agcaaaacgtacataggtttaaactcactcattgaaggccaagactttgtttacgctgag
catattggacagcaaacgtttttaatttttatgtcgctcgtggcaggacttatttttgca
aacgtggcgctccctcctaaaaagagtctataa

DBGET integrated database retrieval system