KEGG   Pseudoalteromonas sp. SM9913: PSM_B0290
Entry
PSM_B0290         CDS       T01374                                 

Definition
(GenBank) putative glycosyltransferase
  KO
K20444  O-antigen biosynthesis protein [EC:2.4.1.-]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psm01005]
    PSM_B0290
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     PSM_B0290
Lipopolysaccharide biosynthesis proteins [BR:psm01005]
 O-antigen
  PSM_B0290
SSDB
Motif
Pfam: Glyco_trans_1_4 Glyco_trans_4_2 Glycos_transf_1 DUF2315
Other DBs
NCBI-ProteinID: ADT70330
Position
II:complement(329861..331084)
AA seq 407 aa
MKKVLVIGYVWPEPNSSAAGTHMMSLLNAFKSQNWDVEFATPAQPTEHMVNLNDYGITSQ
SIALNCDSFDDYVKAYNPDIVMFDRFMMEEQFGWRVDKHCPNALKILDTEDLQCLRNARH
EAHKGEREFNHSDLLSDIAKREIAAILRCDLSLIISSYEMELLNEVFKVEPSVLHHLPFM
VDLSALPEQTKSYDQRQHFMTIGNFRHAPNWDAVLYLQKIWPLIRKQLPQAELHIYGSYP
PPKATALNNPKTGFLIKGWADDAYEVMQSARVCLAPLRFGAGIKGKLLEAMIMQTPSVTT
PIGSEGMHNHLPWPGAITQNAEEFANAAVSIYTNQAEFIAAQKAGNELLNTLYDKAQLSD
NLIEKIQLVSQNLSAHRMKNFTGQMLKHHTMRSTQYMSQWIAEKNKK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaaaaaagtgctggtaattggctatgtatggccagagcccaattcgtctgctgcgggt
acgcacatgatgtcgttacttaatgcgtttaaatcgcaaaactgggatgttgaatttgct
acgcctgcacaacctacagagcacatggtaaatctgaacgattacggcatcaccagtcaa
agcatcgcacttaactgcgatagttttgatgattacgttaaagcctacaacccagatatt
gttatgttcgaccgttttatgatggaagaacaatttggctggcgcgtagataagcattgc
ccaaatgcacttaaaattttagacaccgaagatttacaatgcctgcgcaatgcccgccat
gaagcccataaaggtgagcgtgaattcaaccatagcgatttactatcagacatagctaaa
cgtgaaatagccgctattttacgctgtgacttaagcttaattatctcaagctatgagatg
gaactactcaatgaagtgtttaaagttgagcctagtgtgttacatcatttaccatttatg
gttgatttaagcgccttacctgagcaaactaaatcgtatgatcagcgccaacactttatg
actattggtaattttaggcatgcccctaactgggatgcagtactgtatttacaaaaaatt
tggccgctcatccgcaaacaactaccgcaggcagagttgcacatttatggctcataccca
ccacctaaagccaccgcactcaataaccctaaaaccggttttttaattaaaggctgggca
gatgatgcttatgaagtaatgcaaagcgcgcgcgtttgtttagccccgcttcgttttggt
gctggcataaaaggcaaacttttagaggccatgatcatgcaaaccccaagcgtcaccacg
ccaataggtagcgaaggtatgcataaccatttaccatggcctggtgctatcactcaaaat
gcagaagaatttgcaaacgctgctgtctcaatttataccaatcaggctgagtttatagct
gcacaaaaagctggtaatgagttacttaatacactttatgataaagcgcagttgagcgac
aatttaatcgaaaaaattcaattagtaagccaaaatttatctgcgcatagaatgaaaaat
ttcaccggtcaaatgctaaaacatcacaccatgcgcagcacacaatacatgtcgcaatgg
atagcagaaaaaaataaaaaataa

DBGET integrated database retrieval system