KEGG   Pseudoalteromonas sp. SM9913: PSM_B0292
Entry
PSM_B0292         CDS       T01374                                 

Definition
(GenBank) putative efflux protein
  KO
K05834  homoserine/homoserine lactone efflux protein
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0292
Transporters [BR:psm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PSM_B0292
SSDB
Motif
Pfam: LysE TerC SPC25
Other DBs
NCBI-ProteinID: ADT70332
Position
II:334286..334903
AA seq 205 aa
MIDVAALAVFIPTFFFVSITPGMCMTLAMTLGMSIGVRRTLWMMIGELLGVATVAVAAVL
GVASVMLNYPSAFDILKWLGGAYLIYIGINMWRAKGKMSVDTHNTTAVSRYSLFSQGFVT
AIANPKGWAFMISLLPPFINVQYSVAPQLAVLVAIILLSEFICMMIYATGGKSLRLFLTK
GNNIKWMNRIAGSLMVLVGVWLILG
NT seq 618 nt   +upstreamnt  +downstreamnt
atgattgatgtagctgcacttgcggtatttattcctaccttcttttttgtatcaattaca
cccggtatgtgtatgacactggccatgaccttaggcatgagtattggcgtgcgacgaact
ttatggatgatgataggtgaactactcggtgtagcaacagttgcggtagccgcggtgctt
ggtgtagccagtgttatgcttaattaccccagtgcatttgatattttaaaatggctaggt
ggcgcttatttaatctacattggcattaatatgtggcgtgcaaaaggaaaaatgtcggtt
gatacgcataacacaacagccgtgagccgatattcattattttcacaggggtttgtaacc
gccattgccaatccaaagggatgggcgtttatgatttccttattacctccttttattaac
gtgcaatacagtgttgcgccacagttagcggtgttggtggccattattttactttcagag
tttatctgtatgatgatttacgcaacaggtggcaaaagcctgcggttatttttaactaaa
ggcaataacatcaagtggatgaaccgaattgcggggagtttaatggtgctagtgggggtt
tggttaatactagggtaa

DBGET integrated database retrieval system