KEGG   Pseudoalteromonas sp. SM9913: PSM_B0293
Entry
PSM_B0293         CDS       T01374                                 

Definition
(GenBank) putative transposase
  KO
K07493  putative transposase
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    PSM_B0293
SSDB
Motif
Pfam: Transposase_mut HTH_32 MULE
Other DBs
NCBI-ProteinID: ADT70333
Position
II:335025..336029
AA seq 334 aa
MTQSFDFNKALAELQAGKGLTGEDGVLTPLIKQLTEAALKAELEQHLESETQVNRKNGST
KKTVKSSIGQFELETPRDRSGSFEPQLVKKNQTKLTPEIDEKILSMFALGMSYRDIRGHI
QDMYGVEVSEATITAVTGQLIPELKVWQARSLDTLYPFIWLDAIHYKIKENGRYVSKAIY
TVLGVNIEGRKELLGLYISESEGANYWLSVLTDLHNRGVSDILIACVDGLKGFPEAIATI
YPDAEVQECVIHQIRNSMKYVASKHQKEFMAGLKPVYKAATKDAAEAALAELDAKWGKLY
PIVIESWRRKWGNLSVYFKYPDYVRKAIYTTNGN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactcaatctttcgacttcaacaaagcattagctgaacttcaagctggtaaaggcctt
actggcgaagacggtgttctaacacccttaatcaaacaactcaccgaagcggctcttaaa
gctgaattagagcagcatttagaatctgagacccaagttaaccgtaaaaatggttcaacc
aaaaaaacagttaagtcatccataggccaattcgaacttgaaacgcccagagaccgttca
ggttcgtttgaacctcagcttgttaaaaagaaccaaaccaagttaacgcctgaaattgat
gagaaaatcctatctatgtttgctttaggtatgagctatcgagatattcgaggccacata
caggatatgtatggcgttgaggtatcagaggccaccatcactgccgtaacaggccaactg
ataccagagcttaaagtatggcaagcgcgcagcttagacacgctttacccgtttatctgg
cttgatgccattcattataagattaaagaaaatgggcgctacgtgagtaaggctatttat
accgtactaggtgtcaatatcgagggccgcaaagagttacttggtttatatatctctgaa
agtgaaggggctaactattggttatcagtattaacagatttacataatcgtggtgtatcc
gatattttaattgcctgtgttgatggactaaaaggcttccctgaagcaatagcaacaatc
tatcctgacgccgaagtgcaggagtgcgttattcatcaaattcgtaattcgatgaagtat
gttgcttcaaagcaccaaaaagagtttatggctggcttgaaacccgtttataaggctgcc
actaaagatgcagcagaagccgctctcgccgaattagatgccaaatggggcaagttatac
cctatcgttatcgagtcttggcgtcgtaagtggggcaatctgtcggtttacttcaagtat
ccagattacgtgcgaaaagctatttataccacaaatggcaattga

DBGET integrated database retrieval system