KEGG   Pseudoalteromonas sp. SM9913: PSM_B0294
Entry
PSM_B0294         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: LPP20 GatB_Yqey
Other DBs
NCBI-ProteinID: ADT70334
Position
II:complement(336268..336828)
AA seq 186 aa
MRNKLLILAVAGVITACGTTPQKSQPLAENDSVPSWVLQPTAPEGGLASSSCVVWTGNMA
ASRAQAIANARADLATQISAKAQVMDTLINKQTQQQDSTTTNSSFTQISKQVAEQSLVGA
IAKEIGFARLDGKKQLCALVTMENTKPLFDKLIETSGKNLSPNDEDMLYREFKLKTTTDE
LKALDK
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcgaaataaacttttaatattggcagttgctggagttattacagcatgtggtacaaca
ccacaaaagtctcaacctcttgctgaaaacgattctgttccaagctgggttttacaacct
actgcacccgagggcggtttggcttcatctagctgtgtagtatggacgggaaatatggct
gcaagtagagcacaagctattgccaatgcacgtgccgatctagcaactcaaattagtgct
aaagcgcaagtaatggatacactaataaacaaacaaacccaacagcaagactcaacgacg
actaattcatcatttacgcaaataagtaaacaggtagctgagcaaagcttagtaggggct
attgctaaagaaattggttttgctcgcttagatggaaagaaacagttatgtgcgcttgta
actatggaaaatactaagcctttatttgataaattaatcgaaacgtcaggaaagaattta
agccctaatgatgaagatatgctttatcgtgaattcaaattaaaaacaacaactgatgag
cttaaagcgctagataaataa

DBGET integrated database retrieval system