KEGG   Pseudoalteromonas sp. SM9913: PSM_B0295
Entry
PSM_B0295         CDS       T01374                                 

Definition
(GenBank) putative transglycosylase
  KO
K08306  membrane-bound lytic murein transglycosylase C [EC:4.2.2.-]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psm01011]
    PSM_B0295
Enzymes [BR:psm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     PSM_B0295
Peptidoglycan biosynthesis and degradation proteins [BR:psm01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   PSM_B0295
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: ADT70335
Position
II:complement(336818..338116)
AA seq 432 aa
MRHTLLFFALFSAYSGATTPTFEEFKKQQLAKQTTFKNDHQLEYQAFRQAYLEEYDKFRD
RLLQNWSRPVQSSLLERVEYSADKKTRIIIDEQNSTVTVQTLEDSNETGLKATSQEEALT
TNQLLNNVKLSPVLTDIFKDLSLLDKAVKTAKVDIKAQPDKHESEVALINEITSQHEQSL
SSLDKNEQLPKAQIDIQKEQLTKEKEQRISNLNNALKKTKEQNLTYKRIKSHTFALPDTY
LQKKVAPFVTYYSQFSKDQLSLLLAISHAESSFDPNAKSHIPAFGLMQIVPNSAGLDVAR
KQFKKDIAPTAKELFDPKTNITYGAGYLDILTTRYLRKINNPISRRYCAIAAYNTGAGNV
AKAFNLNRSTNINKAVALINQLDSEGVYAQLINNLPYDETKKYLQKVSKLDIQYQKNLEQ
WNLNNKEVNHAK
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgcgtcacactttattattttttgctttatttagtgcttacagcggggctaccacgccg
acgttcgaagaatttaaaaaacagcaacttgcaaaacaaaccacttttaaaaacgatcat
cagttggaatatcaagcattcagacaagcatatctcgaggaatacgataaatttagagat
agattattgcaaaactggtcaagacctgtacaaagctcattattagaacgtgttgaatat
agtgcggataaaaaaacacgtattattattgatgaacaaaattcgaccgtgactgtacaa
acacttgaagactcaaatgaaacaggactaaaagcgacttctcaagaagaagcattaaca
acaaatcaattgttaaataatgttaaattatcgccggttttaactgatatttttaaagac
cttagcttactcgataaagcagtaaaaacagcaaaagttgatataaaagcacagccagac
aaacatgaaagcgaagtcgcattaattaatgaaattacttctcaacacgagcaatcattg
agtagtttagataaaaacgagcaattacctaaagcacaaattgatatccaaaaagagcag
cttaccaaagaaaaagaacaacgtattagtaatttaaataatgcgctaaaaaaaacaaaa
gagcaaaaccttacctacaaacgcattaagtcgcatactttcgctctacccgatacttat
ttacaaaaaaaagtagcgccttttgttacttattatagccagttttctaaagaccaatta
tctttactattagctatttcacatgctgagtcgtcatttgatcctaatgcaaaatcgcat
attccagcatttggattaatgcaaatagtgccaaactcagcaggcttagatgttgctcgc
aaacaatttaaaaaggatatagctcctacagctaaagaattattcgacccaaaaactaat
ataacttacggtgctgggtacttagacattttaacgactcgatatttgcgcaaaattaat
aatcccataagccgaagatattgtgccattgcagcttataatactggcgctggtaacgta
gctaaagcatttaacttaaatagaagtacgaatataaataaagcggtagccttaataaac
caattagatagcgaaggtgtatacgcacaacttataaataatttaccgtacgacgaaaca
aaaaagtacttacaaaaggtaagtaaattagatattcaatatcaaaaaaacttagaacaa
tggaaccttaacaataaggaagtaaatcatgcgaaataa

DBGET integrated database retrieval system