KEGG   Pseudoalteromonas sp. SM9913: PSM_B0296
Entry
PSM_B0296         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70336
Position
II:complement(338126..338911)
AA seq 261 aa
MSVGNNLEPEANTEENKSLLAKLKGYFILLMVTLMGLGNWADSKALIIEGYNGFITHFTN
QIEEKKITALDIGNYLPYAEKKIGIPQVIKTSSLNTDYEYRYYKNTKYLLTLINKNTRIV
GIAVHSLKYDKAMVPEFTPLIPFNKKMLRVNSLSDVIKSSNEFYFDSHNIKYYMQSKQLN
AQGMFLNLSVGFSNYAPLLDETQKALFKLDELMLTQDDEKALAKTTEILANTAATFYAVS
ELSSEYISDSLLTKYEFNAYF
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctgtaggaaataacttagagcctgaggctaacactgaagaaaataaatctttgtta
gctaaattgaaaggttactttattttacttatggttactttaatgggtcttggaaattgg
gccgatagtaaagcactcataattgaagggtacaacggattcattactcactttacgaac
caaatcgaagaaaaaaagattactgcgctagatattggcaactacttaccttacgctgaa
aaaaaaataggtattccgcaagtaattaaaacatcatctttgaatactgattacgaatat
aggtattacaaaaatacgaaatatttactcacacttattaataaaaatactcgtatagtc
ggcatcgccgtacatagcttaaaatacgataaagctatggtaccggaatttacaccctta
ataccttttaataaaaaaatgctcagagttaatagtctaagcgatgttataaaatcaagt
aacgaattttattttgattctcataatattaaatattatatgcagtcaaaacagttaaat
gctcaaggtatgtttttgaaccttagcgttggctttagtaactacgcaccattacttgat
gaaacgcaaaaagctttatttaaacttgatgagttaatgcttactcaagatgacgaaaaa
gccttagctaaaacaaccgagatacttgctaacactgcggctacattttatgcagtatct
gagctatctagtgaatacatctctgattcattactgaccaagtatgaatttaacgcttat
ttttaa

DBGET integrated database retrieval system