KEGG   Pseudoalteromonas sp. SM9913: PSM_B0299
Entry
PSM_B0299         CDS       T01374                                 

Definition
(GenBank) MarR family transcriptional regulatory protein
  KO
K15974  MarR family transcriptional regulator, negative regulator of the multidrug operon emrRAB
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psm03000]
    PSM_B0299
Transcription factors [BR:psm03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    PSM_B0299
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 AphA_like HTH_34 HTH_IclR FtsK_gamma HTH_Crp_2 TrmB HTH_24 LTXXQ
Other DBs
NCBI-ProteinID: ADT70339
Position
II:complement(341212..341724)
AA seq 170 aa
MKNEKYISNLIGTFATFVSNDIEKQIAELGGRRLSHESALVTIYNHPNETIDVLSKVLGL
THSGAVRLINTLEKEELVERRKSVKDARSVVLYVTDKGSQRVKRVLNSRETATSKILNSF
NDEQKQSFLSLIELALSSLTSEQIEARKICKLCNEGVCRKRGCPVENAIK
NT seq 513 nt   +upstreamnt  +downstreamnt
atgaaaaatgaaaaatacatatcaaatttaatcggcacgtttgccacctttgtttctaat
gacattgaaaagcagattgccgaattaggcgggcgacgcttaagccacgaatcggcactc
gtcactatttacaaccacccaaatgaaaccatagatgtactgagcaaggttttaggctta
acgcactctggtgcggttagattaataaatacgcttgaaaaagaagagcttgtagagagg
cgtaaatcggtaaaggatgctcgctctgttgttttatacgtaactgataaaggaagtcaa
agggttaaaagagtactaaacagccgagaaacagccacctctaaaatactaaatagcttt
aatgatgaacaaaaacaaagctttttaagtttgatagaactagcgcttagcagcctaaca
agcgagcagatagaagcccgtaaaatatgcaaactatgtaacgaaggtgtatgtagaaag
cgtggttgcccagtagaaaatgctattaaataa

DBGET integrated database retrieval system