KEGG   Pseudoalteromonas sp. SM9913: PSM_B0300
Entry
PSM_B0300         CDS       T01374                                 

Definition
(GenBank) haloalkane dehalogenase
  KO
K01563  haloalkane dehalogenase [EC:3.8.1.5]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00361  Chlorocyclohexane and chlorobenzene degradation
psm00625  Chloroalkane and chloroalkene degradation
psm01100  Metabolic pathways
psm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSM_B0300
   00361 Chlorocyclohexane and chlorobenzene degradation
    PSM_B0300
Enzymes [BR:psm01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.5  haloalkane dehalogenase
     PSM_B0300
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 MULE Hydrolase_4 Gag_p30
Other DBs
NCBI-ProteinID: ADT70340
Position
II:341915..342415
AA seq 166 aa
MFLHGNPTSSYLWRNVMPYLQGKGRLIAMDMIGLGDSKKLDNTHESSKYTFALLEALGVN
SNVTLVLHDWGSGVGFNWANTHRDAVKAIALMEAIVTDFPTWDDFLKDLHGPISTLRSAE
GEKMVLDDNFFIETILPATISRQLTQKEHDEYRRPFINPGRIAVQF
NT seq 501 nt   +upstreamnt  +downstreamnt
gtgtttttacatggtaatcctacatctagctacctttggcgaaatgttatgccatattta
caaggaaaagggcgtttaattgctatggatatgattggattaggagattcgaaaaagtta
gataacacccatgaaagcagcaaatacacatttgcacttttagaagcgttgggcgtgaac
agtaatgttactttagtactgcacgattggggctctggtgttggttttaactgggctaat
acacatcgtgatgcagtaaaagcgattgccttaatggaagcaattgttaccgattttcca
acatgggatgactttcttaaggacttacatggcccaattagcaccttgcgctctgctgag
ggtgaaaaaatggtgcttgatgataacttttttattgaaacaatattaccagcgactatt
tcgcgtcaattaacgcaaaaagaacacgacgaatatcgtagaccctttataaatccgggg
aggatcgccgtgcaattttag

DBGET integrated database retrieval system