KEGG   Pseudoalteromonas sp. SM9913: PSM_B0301
Entry
PSM_B0301         CDS       T01374                                 

Definition
(GenBank) putative excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:psm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PSM_B0301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psm03400]
    PSM_B0301
DNA repair and recombination proteins [BR:psm03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PSM_B0301
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      PSM_B0301
SSDB
Motif
Pfam: ABC_tran UvrA_DNA-bind AAA_16 AAA_29 DnaJ_CXXCXGXG AAA_21 SMC_N AAA_15 RsgA_GTPase DUF2075
Other DBs
NCBI-ProteinID: ADT70341
Position
II:complement(342800..345367)
AA seq 855 aa
MAATPKSTYAVTNAKSALLNPEHSIEVRGARVHNLKDVDLNLPRNSLVVFTGISGSGKSS
LAFGTLFAESQHRYLDSVSPYARRLIDQVDEPDVDSIEGLPPAVALQQQRGAPSVRSSVG
SVTTISNALRMLYSRAGEYPKGQGILYADAFSPNTPQGACPECHGIGRVFNVTEELLVPD
PTKSIRDRAIAAWPPAWQGKNLSRILTSLGYDIDKPWNTLPKKARDWILFTDETPTVPVF
PEYTLKQTQAAIKNEENPSYMGTFSSAKRFVLQSFASTQSPRTKKRVSQYMQVSSCPQCD
GKKLKKKSLSVKVAGFDIGEISQLTLSELAQTLSIAASKPAKSNAANPEKAIVAKRIAGD
ILKRVEALTKLGLGYLSLERTTPSLSLGELQRLRLATQIRSKLFGVVYVLDEPSAGLHPA
DTQALLAALDELIAAGNSVFVVEHDVSVIRHADWVVDVGPNASTHGGNIVYSGPVEGLKQ
ISSSHTSQYLFKNEENHLAHIQHKQHKQRRPKAWLSLKNIERNNLQKLDVEFPLGVITSV
TGVSGSGKSSLVSQALVELVYDALGQKSQPQIPTDNAELLEQELDITTEGQITQGIEHIK
RLITVDQKAIGRTPRSNLATYTGLFDHVRKLFANTNEAKARKYDAGRFSFNVKKGRCENC
EGVGFVSIELLFLPSVYSPCPVCNAKRYNQKTLEITYKDKTIADVLNLTVESAHTFFDDE
PAIERALNTLLQVGLGYLRLGQPATELSGGEAQRIKLATELQRAQRGDTLYVLDEPTTGL
HPKDVAMLMTQLNGLVDAGNTVIMVEHDMQVASNSDWVIDIGPGAGDEGGHIVAQGKPEK
VANVKASKTAPFLLK
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggcagctacacctaaaagtacttacgcggttactaatgcgaaatcggctttattgaac
cctgagcacagtattgaagtaagaggcgcacgtgttcataacttaaaagatgtggattta
aacctcccccgtaactcactcgttgtatttaccggtatatctggctctggtaaatcatct
cttgcctttggaacgttatttgccgagtcgcaacatcgttaccttgattcggtatcgcct
tatgcgcgcagattaatagatcaggtagacgagcctgatgtcgattcaattgaaggcctg
ccaccagcggtcgcactccagcaacagcgtggtgcgccatcggtgcgttcatccgtgggt
agcgtaaccactatttctaacgcactgcgaatgttatattcgcgcgcaggcgaatacccc
aaagggcaaggcattctttatgccgatgcgttttcgccaaatacgccacaaggggcatgc
ccagagtgccatggtattggccgcgtatttaacgtaaccgaagagctactggtgcccgac
cccactaaatcaattagggatcgcgccattgccgcatggccaccggcttggcaaggtaaa
aacctaagccgtatacttacctctttaggttacgatattgataaaccttggaataccctg
cctaaaaaagcccgagattggattttgtttaccgacgaaacccctacagtgccagtgttt
cccgagtacacgcttaagcaaacccaagctgctattaaaaatgaagaaaatcctagttac
atgggtacgttttcgagtgctaaacgctttgttttacaatcgtttgcaagcactcaaagc
ccgcgtactaaaaagcgcgtgtcgcagtatatgcaagtatcatcgtgcccacagtgtgat
ggtaaaaaactcaaaaaaaagtcgttatcggttaaagtcgcaggctttgatattggtgaa
atttcgcagttaacacttagcgaacttgcgcaaacattaagtattgccgctagcaagcct
gctaaaagtaacgctgcaaatccagaaaaagctatagtggcaaagcgtatagcaggcgat
attcttaaacgcgttgaagcgttaactaagcttggtttagggtatttatcactggagcgc
acaaccccatcgttatcgctaggggaattacaacgcctaaggcttgcaacgcaaattcgc
tcaaagttatttggtgtagtttatgtgttagatgagccatcggcaggtttacaccctgca
gatacgcaagccttattagccgcattagatgaactaatagccgctggtaactcggttttt
gtggttgaacacgacgtaagcgttattcgccatgccgattgggtggtcgatgtagggcca
aatgctagcacacacggcggtaatattgtttacagcggccctgttgagggtttaaaacaa
attagcagctcacatactagccagtatttatttaaaaatgaagaaaatcacctagctcac
atacaacacaaacaacacaaacaacgccgaccaaaagcatggctatcgcttaaaaatatt
gagcgtaataacttacaaaaactcgatgtagaatttccacttggggttattacaagtgtt
acgggggtatctggctcaggtaaatcgagcttagtaagccaagcgcttgttgaactggtt
tacgatgcacttgggcaaaaatcgcagccacaaataccaacagacaacgctgagctgctc
gagcaagagctcgacataacaaccgaaggacaaataacgcaaggcattgagcatataaaa
cgccttatcacggttgatcaaaaagccattggccgcacacctcgttcaaaccttgcaact
tacacaggcttattcgatcatgtacgaaaattgtttgctaataccaatgaagcaaaagcg
cgtaagtacgatgccggtcgtttttcgtttaatgttaaaaaaggccgctgcgaaaactgc
gaaggtgtaggctttgttagtatagagctgttatttttacctagtgtctattcaccctgc
cctgtgtgtaatgctaagcgctacaaccagaaaacactcgagattacatataaagataaa
accattgccgatgtgcttaatttaacggttgagtcggcgcatacattttttgacgatgag
cccgctattgaacgcgcgctaaatacactgctacaggtaggccttggctatttacgttta
gggcaacccgctactgagctttcaggtggcgaagcccagcgtataaaactggccactgaa
ctacaacgtgctcagcgcggcgatacgctttatgttttagatgaaccaaccactggtcta
catcctaaagatgtggccatgttaatgacgcagttaaatggcttagttgatgctggcaat
accgttattatggtcgagcacgatatgcaagtagccagcaacagtgattgggttattgat
attggcccaggagccggcgacgaaggcgggcatatagttgcacaaggtaaacctgaaaaa
gtggcaaatgtaaaagcgagtaaaacagcaccatttttactgaaatag

DBGET integrated database retrieval system