KEGG   Pseudoalteromonas sp. SM9913: PSM_B0303
Entry
PSM_B0303         CDS       T01374                                 

Definition
(GenBank) LysR family transcriptional regulator
  KO
K21698  LysR family transcriptional regulator, transcriptional activator for aaeXAB operon
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psm03000]
    PSM_B0303
Transcription factors [BR:psm03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    PSM_B0303
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-ProteinID: ADT70343
Position
II:complement(346358..347242)
AA seq 294 aa
MSDKLTKTLNIFVRTVQTGSMSKAAADLLMTTSAISQQIKQIELDVGLSLFNRSPRELTL
TEAGELYYQSCLQMLAVATATSEQLQHLQNCPSGQLKLAAPVGFGGGLLSEPVKHLISQF
SDIDVHLTLSDEPIDMIRTGIDLVLAIGPLEDSNLIARQLASWPLILCVHKNHALAQQPK
ITLDDLKAHNRIAHIAVDPALTHLTRGESTTLPKARIAINNMQTVIQFVLDELGYAILPE
PEVRNFLATGELLEICTDWQLPHYDVFALTPARDTLAAKTKAAIKALNASFSAI
NT seq 885 nt   +upstreamnt  +downstreamnt
atgagtgataagttaactaaaaccctgaatatatttgttcgcacagtacaaacgggaagt
atgagtaaagctgccgcagaccttttaatgacaacctctgcaattagccagcaaataaaa
caaatagagctagatgtaggtttgagtttatttaatcgcagccctcgagaattaacgctt
accgaggccggtgagctgtattatcaaagttgtttacaaatgcttgccgttgcaacagct
acatcagaacaattacagcatttacaaaattgcccgagtgggcaattaaaactagcagcc
cctgttggttttggaggtgggttactaagtgagcctgtaaagcatttaattagccaattt
agtgatatagatgtgcacttaacgctttctgacgagccgattgatatgatcagaacaggt
atagatttagtgctggcaattggtcctctcgaagactcaaacttaattgcacgccaactc
gctagttggccattaatactgtgtgttcataaaaatcatgcactagcacagcaaccaaaa
atcacactggatgacctaaaagcgcataaccgcattgcacatatagctgttgatccggcg
cttacgcaccttacccgcggtgaaagcacaacactaccaaaagcgcgtattgccattaat
aatatgcaaactgtgattcaatttgttctcgacgagttaggctatgctattttgccagag
cctgaagtacgtaattttttagctacaggagaacttttagaaatatgcacggattggcag
cttccccattacgatgtatttgctctaacgcctgcacgcgacacgttagcagcaaagaca
aaagctgcaattaaagcacttaacgcatcattttcagctatttaa

DBGET integrated database retrieval system