KEGG   Pseudoalteromonas sp. SM9913: PSM_B0304
Entry
PSM_B0304         CDS       T01374                                 

Definition
(GenBank) enterobactin receptor protein
  KO
K16089  outer membrane receptor for ferrienterochelin and colicins
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0304
Transporters [BR:psm02000]
 Other transporters
  Pores ion channels [TC:1]
   PSM_B0304
SSDB
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3 Porin_4 DUF2490
Other DBs
NCBI-ProteinID: ADT70344
Position
II:347364..349349
AA seq 661 aa
MNTVSCKLRPVTAFILSTFAIANPAFADEKKQDMEVMVVTASGYEQMLKEAPASISVIDR
AQLEKRFYRDLTDAMADIPGVIVTGGGDRKDISLRGMASQYTLILIDGQRQSSRETRPNS
DGPGVEGAWTPPISAIERIEVIRGPMSSLYGSDAIGGVINIITRKAPEQWYGELRLDSTI
QEQSQSGDINQASFFTSGGIIPDLLGVQLYGQFSKRNEDEFTAGFRGKEQSNVKAKFTLT
PNDSHELMFELGSAKQTLDETLGKTVAPLAPGENCGRRGCPESATTEYEQQTYSMSHNGF
YDFGSSRSYIKYDKFDNNSREMFIENTDIQTTWSLPLFSDHNSTFGATYLKESLDDYTSN
KISDLTHVENEQWSVFGENEWAATDDFKLTAGLRYDHDGNFAGHWSPRLYGVYSASKTIT
IKGGISTGFRAPNIRQSTAQWGQVSRGGNIYGNPDLKPEQSVNYEMGVYYDSGRDLSIST
TVFYNEFDDKITRIACPLTQCTDGPNQFGSMPTTYINVDEAKTQGIEISIDYDISTEIDV
SASYTYTDSEQKTGQYKGSPLNQLPKHSLQTSLNWRPTDKLGGWLRVQYRGEESQPTTGP
SQSSLIAPDYTIANLGANYQLSDSVKLGAGIYNFLDKEITEQEYGYVEDGRRYWASLVWQ
F
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaacacggtaagttgtaagttaaggccggtaactgcatttattttaagtacttttgca
attgctaaccctgcttttgctgatgaaaaaaaacaagatatggaagtaatggttgtcact
gcttctggttacgaacaaatgctcaaagaggcacctgcaagtattagtgttatagacaga
gcgcagctagaaaaacgcttttatcgtgacttaactgacgcaatggctgatattccgggt
gtaatagtgaccggcggaggcgacagaaaagatattagcttgcgtggtatggctagccaa
tacacgcttattcttattgatggacaacgccaaagctcaagagaaacacgacctaatagt
gatggcccaggcgtagaaggtgcttggacgccgccaatttcagcgattgaacgtattgaa
gtaatacgtggccctatgtcgtcgttgtatggctctgatgctattggtggtgtcatcaat
attattacccgtaaagcgccagagcagtggtacggtgaactgcgtttagacagcaccatt
caagagcaaagtcagtcaggtgatataaaccaagccagctttttcacttctggtggcatt
attccagatctattgggcgtgcaattgtatgggcagttttcaaagcgaaatgaagatgag
tttactgcaggatttcgaggtaaagaacaaagtaatgttaaagccaagttcacattaaca
cctaatgatagtcacgaattaatgtttgaacttggctcggcaaaacaaacattagacgaa
acacttggtaaaacagttgccccgcttgcgccaggtgaaaactgtggtcgacgtggctgc
cctgaatcagcaactactgagtatgagcaacaaacatactctatgtcacacaacggtttt
tacgactttggctcgtcgcgtagttacattaagtacgataagtttgataataactcacgt
gaaatgtttatcgaaaataccgacattcaaacgacatggagtttaccgctatttagtgat
cataactctacgtttggtgcgacctatttaaaagagtcattggatgattatacaagcaat
aaaattagcgacttaacccatgtagaaaacgagcaatggtcagtttttggtgaaaacgag
tgggcagctacggatgactttaagcttaccgcaggcctacgttacgatcatgatggcaac
tttgcgggtcattggagcccacgtttgtatggtgtttatagcgcatctaaaacaatcacc
atcaaaggcggcatatcaacgggtttccgtgcgccaaatattcgccaatctaccgcgcaa
tggggacaagtgagtcgtggcggtaatatttatggtaaccctgacttaaagcctgagcaa
tcagttaactatgaaatgggtgtttactatgattctgggcgagatttaagcatatcgaca
accgttttttataatgaatttgatgacaaaataacccgcatagcatgcccattaacgcag
tgcacagatggcccaaatcagttcggctccatgccaactacctacattaatgtggatgaa
gccaaaacccaaggtattgagatatccatagattatgatatttcaactgaaattgatgtg
agtgccagttatacctacaccgactcagagcaaaaaaccggtcaatataaagggagccca
cttaatcagctaccaaaacatagtttacaaacgtctttaaattggcgtccaacagataag
ttaggcggatggttacgtgtgcaatatcgtggagaagaaagccagcctaccacagggcct
tcacaaagtagtttaattgctcctgattataccattgccaatttaggcgctaattatcag
ctaagtgacagcgttaaacttggtgctggaatttacaacttccttgataaagagatcaca
gagcaagagtatggctatgttgaagatggccgtcgctattgggcgtctttagtgtggcag
ttctaa

DBGET integrated database retrieval system