KEGG   Pseudoalteromonas sp. SM9913: PSM_B0305
Entry
PSM_B0305         CDS       T01374                                 

Definition
(GenBank) putative kinase
  KO
K07178  RIO kinase 1 [EC:2.7.11.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psm01001]
    PSM_B0305
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psm03009]
    PSM_B0305
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PSM_B0305
Protein kinases [BR:psm01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   PSM_B0305
Ribosome biogenesis [BR:psm03009]
 Eukaryotic type
  Pre-40S particles
   Kinases
    PSM_B0305
SSDB
Motif
Pfam: RIO1 APH Kdo YrbL-PhoP_reg Pkinase Pkinase_fungal Aph-1
Other DBs
NCBI-ProteinID: ADT70345
Position
II:349619..350473
AA seq 284 aa
MKIPKRLQPLVDDGFIDEVISRLMSGKEADVFVVACGDDIRCAKVYKDASKRSFKKAAQY
QEGRKVRSGRQARAMGKRSSYGRQLEEEIWQNAEVDALSRLSSAGVRVPQTYGCIDGVLL
MELVSDDEGDVAPQLGAVDLTEKQAIEQHTLMMHYIKLMLCAGIIHGDLSEFNVLVDSNG
PVIIDLPQAVNASANNSAEAMFARDVNNMRRYYGQFAPALLHTQYAKEMWALYEDANLTP
HSKLSGEFEDDSEAADVDSVLDEIQAAFDEEQERKERIRDADEQ
NT seq 855 nt   +upstreamnt  +downstreamnt
ttgaaaatacctaaacgcttacagccattagttgatgatggttttattgatgaagtgatc
agccggttaatgagcggtaaagaggccgatgtatttgtagtggcctgtggcgatgacatt
cgctgcgctaaagtatacaaagatgccagtaagcgaagttttaaaaaagccgcccagtat
caagagggccgcaaagtacgcagtggccgacaagcccgtgctatgggtaaacgttcaagc
tatggccgtcaattagaagaagaaatttggcaaaatgccgaggttgacgcactctcgcgt
ttatcctcagcaggtgttcgggtaccgcaaacttacggctgcattgacggtgttttgtta
atggaacttgtaagtgatgacgaaggcgatgttgcaccacaacttggcgcagttgattta
accgagaaacaagccattgaacaacatacattaatgatgcactacatcaaactaatgcta
tgcgctgggattattcacggtgacttatctgaatttaacgtacttgtagatagcaacggc
ccagtaattattgatttaccccaagcggttaacgcctctgctaataatagcgccgaagcc
atgtttgcccgcgatgtaaataacatgcgccgctattatggccaatttgcacctgcgtta
ttacacacgcaatatgccaaagaaatgtgggcactgtatgaagatgctaacttaaccccg
cactcaaaactcagtggcgaatttgaagacgacagcgaagctgcagatgtagattcagta
cttgacgaaattcaagccgcctttgatgaagagcaagaacgtaaagaacgcattcgcgac
gctgatgagcaataa

DBGET integrated database retrieval system