KEGG   Pseudoalteromonas sp. SM9913: PSM_B0307
Entry
PSM_B0307         CDS       T01374                                 

Definition
(GenBank) integrase catalytic subunit
  KO
K07497  putative transposase
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    PSM_B0307
SSDB
Motif
Pfam: rve rve_3 rve_2 HTH_21 DDE_Tnp_IS240
Other DBs
NCBI-ProteinID: ADT70347
Position
II:complement(351582..352412)
AA seq 276 aa
MLCNVFNVHRSSYKYWAIRDTTPTPEQVRLEAEVKAIHAMSGGSAGARTIAAIATNNGFE
LSRYRAAKLMVKLKLESCQVPQHSYKRGGNEHLEIPNLLDRQFDVVEPDTVWCGDVTYIW
VGNRWAYLAVVIDLFARKVVGWAMSLSPDTNLTLKALELAYESRGKPTGLMFHSDQGSHY
TSLKYRQRLWRYKIKQSMSRRGNCWDNAPMERFFRSFKTEWMPKVGYENFRDAKYSVSDY
INGYYNNVRPHHYNAGLAPNESEIRYQDSKTVAKIS
NT seq 831 nt   +upstreamnt  +downstreamnt
gtgctgtgtaacgtattcaatgtgcatcggagcagctataaatattgggctatacgggat
acaacgccgacgccagagcaagtaaggctagaggctgaagttaaagcaatacatgcaatg
agcggcggctcagctggggcgcggacaatcgcggcaatagcaacgaacaatggttttgaa
ttgagtcgttatcgtgctgctaagctaatggttaaattaaagcttgaaagctgccaagta
cctcaacattcatataaacgtggtggtaatgaacaccttgaaattccaaacctgcttgat
agacaatttgatgttgttgagccagataccgtgtggtgcggtgatgtgacgtatatttgg
gtaggtaatcgctgggcttatttagccgttgttattgatttatttgcacgtaaagtagtt
ggctgggccatgtcgttgtcgccagatactaatttaacgctaaaagcacttgaactcgcg
tatgaaagcagaggaaaaccgacaggactgatgtttcattcagatcagggtagtcattat
acaagtttaaaatatcgtcaacgtttatggcgctataaaatcaaacaaagtatgagtagg
cgcggaaattgttgggataatgcgccaatggaacgattttttagaagctttaagacggaa
tggatgccaaaagttggatatgaaaactttagagacgctaaatatagtgtgagtgattat
atcaacggatattacaataatgttagaccacatcattataatgctggtttagcgccgaat
gaatctgagattagatatcaagattctaaaactgtggccaaaattagttga

DBGET integrated database retrieval system