KEGG   Pseudoalteromonas sp. SM9913: PSM_B0309
Entry
PSM_B0309         CDS       T01374                                 

Definition
(GenBank) histone acetyltransferase HPA2-like acetyltransferase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Acetyltransf_7 Acetyltransf_1 Acetyltransf_10 Acetyltransf_15
Other DBs
NCBI-ProteinID: ADT70349
Position
II:352864..353358
AA seq 164 aa
MDTTIRKAESIDIAAIKMLWQFYQYHQSIFDLEDVGLDGCYDIDEEYLECVVRGEEDCII
YLVLVSNQIAGFATVEPTEIVGKEIPELADIFILPKYRKQGIAKFVIQNLMPVETNQWHV
AVHLNDSSALKFWNSLFAKLNVVRVDKVDPPETEGYHEFVITNN
NT seq 495 nt   +upstreamnt  +downstreamnt
atggacactacaatacgaaaagctgaatcaatcgatatcgctgcaataaaaatgctatgg
cagttttaccaatatcatcagagtatatttgacttagaagatgttggtttagatggttgc
tatgatattgatgaagaatatttagaatgtgtagtgcgtggtgaggaagactgcattatt
tatcttgtactcgtttctaaccaaattgctggttttgctaccgtagaaccaactgagatc
gttggcaaagaaatacctgagttggctgatatttttattctacccaaatatcgaaaacaa
ggcattgctaaattcgttattcaaaatttgatgcctgttgaaacaaatcagtggcatgta
gcagttcatttaaacgatagttcagcgttgaaattttggaatagtttgtttgctaaatta
aacgttgtgcgtgttgataaagttgacccccctgaaacagaaggctaccacgagtttgtt
atcacaaataactag

DBGET integrated database retrieval system