KEGG   Pseudoalteromonas sp. SM9913: PSM_B0310
Entry
PSM_B0310         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70350
Position
II:353478..353594
AA seq 38 aa
MKMSAARILVHLTLLKSFRKLCDSNTLGYLLKLYKLDK
NT seq 117 nt   +upstreamnt  +downstreamnt
atgaaaatgagcgctgcgcgcatattggttcatttaactttacttaaaagttttagaaaa
ctttgtgatagtaataccttaggttatttgttaaaactatataagctagataaatga

DBGET integrated database retrieval system