KEGG   Pseudoalteromonas sp. SM9913: PSM_B0311
Entry
PSM_B0311         CDS       T01374                                 

Definition
(GenBank) putative restriction endonuclease
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: HNH HNH_5 Endonuclease_7
Other DBs
NCBI-ProteinID: ADT70351
Position
II:353662..354447
AA seq 261 aa
MLNAKFYETYYFCNVIKNTLQDQFELARALNEFYGDGNVTYLIETFPKFSLFHKYLYFVI
NRIYYENLNKFAENKSKRLPIEGALKFHSIPHISFQSYMEKNENNTKHYDDLIHNYMEHL
NDAYDQLLTHTVEEVFYILFQNRDLLMEFNLMISGALEREDLKEIDSDLVTKRGRLKRGH
IPQWVKRAVYFRDRGQCVLCNKDLSGIVSLDNKENYDHIVALAQYGFNDVTNIQLLCKEC
NQNEKKAGEAVTSNSYQKWYK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgttaaacgctaaattttatgaaacgtattatttttgtaatgtgattaagaataccctt
caagatcaatttgaattggctagagctctgaatgaattttacggtgatggtaatgtcacc
tatttgatagaaacgtttcctaagttttcactttttcataaatatttatattttgtaata
aatcgtatttactatgagaatttaaataagtttgctgaaaataaaagtaaacgactacct
attgaaggagccctaaaatttcattctatccctcatatatcattccagagttatatggag
aagaatgaaaataatactaagcattatgatgatctgattcataattatatggaacatctg
aatgatgcttatgatcaattattaactcatacagtcgaagaagttttttatattcttttt
caaaatcgagatctgctcatggaatttaatttaatgatttcgggagcacttgaaagagaa
gaccttaaagaaattgatagtgatcttgtaactaaacgaggtagattaaaacgaggtcat
ataccgcaatgggttaagagggctgtatattttagagatcgagggcaatgtgtcctgtgt
aataaagatctatctggtattgtaagcctcgacaacaaagaaaattatgatcacattgta
gcacttgctcaatatggctttaatgatgtaacaaatatccagttgctgtgtaaagagtgc
aatcaaaatgagaaaaaagcaggagaggctgtaacttctaactcatatcaaaagtggtac
aaataa

DBGET integrated database retrieval system