KEGG   Pseudoalteromonas sp. SM9913: PSM_B0312
Entry
PSM_B0312         CDS       T01374                                 

Definition
(GenBank) TonB2 protein
  KO
K03832  periplasmic protein TonB
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0312
Transporters [BR:psm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PSM_B0312
SSDB
Motif
Pfam: TonB_C DUF3757
Other DBs
NCBI-ProteinID: ADT70352
Position
II:355116..355481
AA seq 121 aa
MKYITIFLVLLLVGCNSTDKVANSSIVYINAQTDSPAKWVVKIEPKYPEDAAKKSVEGYL
KFKAIVNEVGALERVEVIESAPKGVFEKEGLRALKLWRFKPALLNGRLVKVEYAGTLEWK
L
NT seq 366 nt   +upstreamnt  +downstreamnt
ttgaagtacataactatatttttagtccttttactggttggttgtaatagtactgataaa
gtggcaaattcaagtattgtgtatatcaatgcgcaaacagattcacctgctaaatgggtt
gtgaagattgaaccaaaatatcctgaagatgcggctaaaaaaagcgtagagggctactta
aagttcaaagcaatagttaatgaagttggagcgttagaaagagttgaagtaattgaatct
gccccaaaaggtgtatttgaaaaggaaggtttacgggctttaaagctatggcgatttaag
cctgcgttattaaatggtaggctggttaaggttgagtacgcaggtactctcgagtggaag
ttataa

DBGET integrated database retrieval system