KEGG   Pseudoalteromonas sp. SM9913: PSM_B0313
Entry
PSM_B0313         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Other DBs
NCBI-ProteinID: ADT70353
Position
II:355616..355729
AA seq 37 aa
MLKAKHQESLKLNAKLGKYLFIAAVVIGVLLFVSFLW
NT seq 114 nt   +upstreamnt  +downstreamnt
atgcttaaggctaaacatcaagaatctcttaaactcaatgctaagcttggtaaatactta
tttatagctgctgttgtaattggtgtattactttttgttagttttttatggtag

DBGET integrated database retrieval system