KEGG   Pseudoalteromonas sp. SM9913: PSM_B0315
Entry
PSM_B0315         CDS       T01374                                 

Definition
(GenBank) putative Outer membrane TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psm02000]
    PSM_B0315
Transporters [BR:psm02000]
 Other transporters
  Pores ion channels [TC:1]
   PSM_B0315
SSDB
Motif
Pfam: TonB_dep_Rec Plug Big_9
Other DBs
NCBI-ProteinID: ADT70355
Position
II:complement(357567..359981)
AA seq 804 aa
MFKPSLLTLAVSSALSGVLFSSNAVAQEQVIEKNKSLEVIEVTATRRSGSIQAAPLNITA
LDADVMKDQNISELADVARWVPGLTITDQGGRAGSPIIVRGLNTNSSGPSSDGGTVATYI
NEIPVSVDMRLVDVERVEVLIGPQGTLYGAGTLGGAIRYMLKEPELDFTSGEVFGDVFQT
QESDSVGGEAGFIFNLPLIEDKLAVRTSLNIYEDPGFIDYAYTVREPGVSITDPDWTNLD
AVNSNLKNVKDANGETTTTGRMSLRYKANESFEGTLNYFYQKQDTEGRSIVHHNSLNENN
GLNDRIGKYESAYRFEEPREKEDQLLSLELKADLGFAELVSATGISHFEADGQRDQTDLL
IRLDYGYEEFPSFSAFTRELDEVDTFTQELRLVSQSDSDLSWIVGGFYNKTDTDASSREF
TPGFDQFAVDNFGGAQLRPDSLEYLEITGSKVTESALFGEVGYQVTDKLDITIGARFYEY
DVESKAAFDFPLANTLYEGAAPDAISINFEENKAGDNGNLFKFNAKYQFTDSVMAYATIS
EGFRIGGSNGLVPCPTPLPEDQQTGCGTPDEMLYDADTTTNYELGFKSTWFRSQLHFNAA
LFNVDWDNAQIAGATTVGQLPYLSNAGSANAKGIEIATRAILSDSFTAYATYAYTKAELT
SDAPYLFNADGTDGAKDGDRLPGSPEHQFSMGINYQTEVFNDKTLDINYGLTAQSDVISK
VGLRDNGEALPGYSLSNISAKLTADAWSTTLYVDNLFNKYAVTSVRRSDADITTANGADI
QRNYGYYINRPLTVGIKFNYKFEI
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgtttaaaccaagcctgttaaccttggctgtatcaagcgcactgagcggtgtattattt
agcagtaatgcagtggctcaagagcaagttattgaaaagaacaaatcgcttgaagttatt
gaggttacagcaacgcgccgaagtggctcaattcaagctgcgcctcttaacattaccgcg
ctcgatgctgatgtaatgaaagatcaaaacatcagtgagctggccgatgtagcacgttgg
gtacctggcttaacaattacagatcaaggtggccgtgccggttcacctattatagtccgt
ggtttaaatactaattcatcagggccttcatcagatggtggcactgttgccacttatatt
aatgaaattcctgtctcagttgatatgcgtttagttgatgtagagcgtgtggaagtgctt
attgggccgcaaggcacattatatggggctggcacacttggtggcgctattcgctacatg
cttaaagaaccagagcttgatttcacctcaggtgaagtatttggtgatgtttttcaaact
caagaaagtgattcggtcggtggtgaagcgggctttatcttcaatttaccattaattgaa
gacaaacttgctgttcgtaccagcttaaatatttatgaagacccagggtttattgactac
gcctacaccgttcgtgaaccaggtgtgtcgatcaccgaccctgattggacaaatcttgat
gcagtaaacagcaatcttaaaaatgtaaaagacgccaacggtgaaaccaccacaactggg
cgtatgtcattacgttacaaggcaaacgagtcattcgaaggcacattaaactacttctat
caaaagcaagacaccgaaggtcgctcaattgttcatcacaatagcctaaacgaaaataat
ggtttaaatgatcgcatcggcaaatacgagtcagcgtaccgttttgaagagccacgggaa
aaagaagatcaattactcagccttgaacttaaagccgacttaggttttgctgagctggta
tcagctaccggtatttcacactttgaagccgatggtcaacgcgaccaaactgacctttta
attcgtttagactatggctacgaagagtttccttcgttttcagcatttacccgtgaatta
gacgaagtcgataccttcactcaagagctacgtttggtctcacaaagcgatagcgaccta
agctggattgttggtggtttttacaacaaaaccgatactgatgcatcaagcagagagttt
acaccaggctttgatcagttcgcggttgacaactttggtggcgcacagctaagaccagac
tctttagaatatttagaaattactggtagcaaagtcactgaatctgcactttttggtgaa
gtgggttatcaagtaaccgataaactcgatattactattggcgcgcgtttttacgaatac
gacgtagaatcaaaagcggcttttgacttcccattagcaaataccttgtatgaaggtgct
gcacctgatgcaatctcaattaattttgaagaaaacaaagcgggtgacaacggtaatctg
ttcaaatttaatgctaaataccaatttacagattcagtaatggcgtatgcaactataagt
gaaggatttagaattggtggctcaaatggcttagtaccttgtccaacacctctacctgag
gaccaacaaacaggctgtggtacaccagatgaaatgctatacgatgcagatacaaccacc
aactatgagctaggctttaaaagtacatggtttagaagccaactacactttaatgccgca
ctattcaatgtagattgggataacgcacaaattgccggtgcaacaacagtaggccaatta
ccttacttatcaaatgctggtagcgcaaatgcgaaagggattgaaattgccacgcgtgca
attttatcagactcgtttactgcctatgcaacttatgcctatacaaaagcagagctaacc
tcagacgctccgtatttatttaatgccgatggcactgatggcgcaaaagatggcgaccgt
ttaccaggctcacctgagcaccagttctctatggggattaactaccaaacagaagtgttt
aacgacaaaaccctcgatataaactacggtttaactgcacaaagtgatgtaatttcaaaa
gtaggcctacgtgacaacggtgaagcactcccgggttatagcttaagtaatatttcagct
aaattaaccgccgatgcatggtcgactacgttatatgtagataacctatttaataaatat
gcggtgacttctgttcgtcgctcagatgcggatattacaacagccaatggcgcagacata
caacgtaactatggttactatattaatcgcccgcttactgttggcattaaatttaactat
aagtttgaaatataa

DBGET integrated database retrieval system